Details for Lyrate rockcress Locus 16042634

Position : sca3 ( 5`- 1850014 .. 1851116 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042634

Protein [Map View]
MASEDESIEQKAAARKEALNALRAAQELSETKEDGEDEAVEEDGPAMKFRNYVPQAKELQDGKLAPPELPKFEDPILALP
PAVEKKEDPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMEEHEKERETAEADGNTIES*

DNA
ATGGCTAGTGAAGATGAATCGATAGAACAAAAAGCTGCTGCTCGTAAAGAGGCACTTAATGCTCTAAGGGCAGCTCAGGA
ACTGTCTGAGACCAAGGAGGACGGAGAGGATGAAGCTGTCGAAGAAGATGGTCCAGCCATGAAGTTTAGAAACTATGTTC
CCCAAGCTAAGGAGCTTCAGGATGGTAAACTTGCCCCACCAGAGTTACCCAAATTCGAAGATCCGATTCTTGCACTTCCA
CCTGCTGTGGAGAAGAAAGAGGACCCATTTGTTAACATCGCTCCAAAGAAGCCGAACTGGGACCTCCGAAGAGATGTGCA
GAAGAAGCTTGATAAGCTCGAAAGGCGGACTCAAAAGGCAATGTATAAACTCATGGAGGAGCATGAGAAAGAACGTGAGA
CGGCTGAAGCTGATGGTAACACCATAGAAAGTTGA