Details for Lyrate rockcress Locus 16042618

Position : sca3 ( 5`- 2055547 .. 2048643 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042618

Protein [Map View]
MAPKPSESETKDGSSSETQSAEAMEISTGDDSSLLGKRKVEATNLEDPGENEEGVDDEDVIDEEDKDSDSDPEWDKDSFD
GREYHSSDDEREYIDKDLEKRARFYKRTVIETKGFFETSDKLPPCVYYGVGSLGYLDEPAMLGLTTREVCEKLTTSLCLQ
RYNEEEGKLQTIWSMTKFYITFAARESESPDAPLVEYQAKAVWSVTHKIYPILCRPSPAPTRMAPKSSDGESNYGSSSAG
DTKDGSSSKTQSTESMEISTGDESSMLGKRKVETTNLEDLNENEGDVEGVDEEENSESDSDSEWDKDSFDGLEYRSSDDQ
KEYIDKDLEKRARFYKRTVIETKGFFEATDEFPPYLWAGIATVPGLDDDLEEGLTVRQFLANMTSLCLDKYNKRKGFNVK
LEHVLRANFNPGGRTTYYITFAARESDSPDAPLVEYQAKVDWSAGKTYPILCRPTSPPKLGNSFHLSYSDFNM*

DNA
ATGGCTCCCAAACCAAGCGAGAGCGAGACCAAGGATGGATCTTCAAGCGAAACCCAATCGGCGGAGGCCATGGAAATATC
CACGGGCGATGACTCTTCTTTGCTGGGGAAGCGTAAGGTCGAAGCCACCAACCTGGAGGATCCCGGTGAAAACGAAGAAG
GTGTGGACGACGAGGATGTCATAGATGAGGAGGATAAGGATAGTGATAGTGATCCCGAATGGGATAAGGATAGCTTCGAT
GGCCGGGAGTATCATTCTTCTGATGATGAGAGAGAGTATATCGACAAGGACCTTGAGAAGAGGGCCCGTTTTTACAAGCG
CACGGTCATCGAAACCAAGGGTTTCTTTGAGACATCAGATAAATTGCCTCCTTGCGTTTATTATGGAGTTGGTTCGCTCG
GATATCTGGACGAGCCGGCTATGTTAGGCCTTACCACCCGTGAGGTCTGCGAAAAGTTGACGACATCTCTATGTCTCCAA
CGGTACAACGAAGAGGAGGGCAAATTACAAACCATATGGTCGATGACTAAGTTTTACATTACGTTTGCTGCAAGAGAGTC
CGAGTCTCCAGATGCACCTTTAGTGGAGTATCAAGCTAAAGCGGTATGGTCTGTAACCCACAAAATTTATCCCATCCTTT
GCAGGCCAAGTCCCGCACCTACAAGGATGGCTCCCAAATCAAGCGATGGCGAGAGCAATTATGGATCTTCAAGCGCCGGC
GATACGAAGGATGGATCTTCGAGCAAAACCCAATCGACGGAGTCCATGGAAATTTCCACGGGCGATGAATCTTCTATGCT
GGGGAAGCGCAAGGTTGAAACCACCAACCTGGAGGATCTCAATGAAAACGAAGGCGACGTAGAAGGTGTCGATGAGGAGG
AGAATAGTGAGAGTGATAGTGATTCCGAATGGGATAAGGATAGCTTCGATGGTCTGGAATATCGTTCCTCTGATGATCAG
AAGGAGTATATCGACAAGGACTTGGAGAAGAGGGCCCGTTTTTACAAGCGCACGGTCATCGAAACCAAAGGTTTTTTTGA
GGCAACTGACGAATTCCCACCTTACCTCTGGGCTGGAATTGCTACAGTCCCGGGTCTGGACGATGACCTTGAGGAAGGTT
TGACCGTTCGTCAGTTTCTAGCAAACATGACATCTCTATGTCTTGACAAATATAACAAACGAAAGGGATTCAATGTGAAG
TTGGAGCATGTTTTGAGGGCTAATTTCAACCCAGGGGGCAGGACAACATACTACATCACATTTGCTGCAAGAGAGTCTGA
TTCTCCTGATGCACCTCTAGTGGAGTATCAAGCTAAGGTGGATTGGTCTGCGGGCAAGACTTATCCCATCCTTTGCAGAC
CCACTTCTCCACCAAAACTGGGTAATTCTTTTCACCTCTCATATTCAGATTTTAACATGTAG