Details for Lyrate rockcress Locus 16042603

Position : sca3 ( 5`- 3688593 .. 3688255 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042603

Protein [Map View]
MDTKLIVLCFLLTYSLSMAAASSEAEPPTTRKLGRHDWPGAEAEAPEVSHLEETVRRGHHHSTVERSVAGGGVILGGLAT
TFLVVVFCYIRATRKHKPNYDEKETETPKVLV*

DNA
ATGGATACAAAACTTATAGTTCTATGCTTCTTGCTAACGTACTCCTTGTCCATGGCGGCAGCTTCATCGGAAGCTGAGCC
TCCAACAACAAGGAAACTCGGAAGGCACGATTGGCCAGGAGCGGAGGCAGAAGCACCAGAAGTTTCACATTTGGAAGAGA
CTGTACGGCGAGGCCATCACCATTCCACGGTGGAAAGATCGGTCGCCGGCGGTGGAGTTATTCTCGGAGGCTTAGCGACT
ACGTTTCTTGTGGTGGTGTTTTGCTATATAAGGGCTACGAGGAAACACAAACCCAATTATGATGAAAAGGAGACTGAGAC
GCCTAAGGTGTTAGTTTAA