Details for Lyrate rockcress Locus 16042597

Position : sca3 ( 5`- 7117838 .. 7119154 -3` )
Annotation : [B2G] 60s ribosomal protein l19
External links : CoGe
PGDD synteny : 16042597

Protein [Map View]
MVSLKLQKRLAASVMKCGKGKVWLDPNESGDISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARALNEAKRKGRHSGYGK
RKGTREARLPTKILWMRRMRVLRRFLSKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKMKAEKAREKTLSDQFE
AKRIKNKASRERKFARREERLAQGPGGGETTTPAAAPVPQQAEVTKKKS

DNA
ATGGTGTCGCTGAAGCTCCAGAAGCGGCTCGCCGCATCCGTAATGAAATGCGGGAAGGGAAAAGTTTGGCTCGATCCCAA
TGAATCTGGCGATATCTCTATGGCCAATTCCCGGCAGAACATTAGGAAGCTTGTGAAGGATGGTTTCATTATCAGGAAGC
CTACCAAGATCCACTCACGTTCTCGTGCCAGGGCTTTGAACGAGGCCAAGCGAAAGGGTCGTCACTCTGGATACGGTAAG
AGAAAGGGTACAAGAGAGGCAAGGCTACCAACCAAGATTCTTTGGATGAGGAGAATGAGGGTGTTGAGGCGTTTCTTGAG
CAAGTACCGTGAGTCAAAGAAGATTGATAGGCACATGTACCATGACATGTACATGAAAGTGAAGGGTAATGTGTTCAAGA
ACAAGCGTGTGCTTATGGAGAGTATCCACAAGATGAAGGCTGAGAAGGCCAGAGAGAAGACACTCTCTGACCAGTTTGAG
GCTAAGCGTATTAAGAACAAGGCTAGCAGGGAGAGAAAGTTTGCCAGAAGAGAGGAGAGATTAGCTCAGGGACCTGGAGG
TGGAGAGACAACAACTCCTGCTGCTGCGCCAGTACCTCAACAAGCAGAGGTAACGAAGAAGAAGTCGA