Details for Lyrate rockcress Locus 16042582

Position : sca3 ( 5`- 11047243 .. 11044576 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042582

Protein [Map View]
MAESNQISRKRMRFSSPSATEILTLRISQNQRIATAARVHQSPSLYGKIDSKIVRTYPRVTIKDIRLRRIFSPTPISTDC
ECNGKGNVDGDNFRQTTPPDSELLSSVPIREDINGSAVKKSDTNLCSKSVLHPCSRPKIFKNTGSFSYKRLLPYLMQASD
DGTSSSQCSKPLSQNPPSMSLSCNKETGETVEDLKEESDRVFDKDSAGSLCGNTSPLTRVNASLPNKRAACSKRKLFKTP
GSVNYRRMLPYLKDIQEDNPFDHQKNTEEVTPSSMLISENEGTQEVVTSNVTRESDICSNKNEEPLSCERLSVFPEQSDP
DKEQETQIKHVISDTENNLGSEIPLSSPLVGSRSSSEVASSALHNTFLDNLVGEGNMNGAEITEAKTSVEQLEANTSDAT
AELIDPSVILATPPSISPSKGILKRSMRGCRGICSCLNCSSFRLNAERAFEFSRNQLQDTEVMVLDLVGEISHLRDMLEK
YKSEDHSESYKSQAGEAAKRACEAAELAKSRLHQMNDDYQVHCRIPNEQRARVKFAHYVHEKTMNLPN*

DNA
ATGGCGGAATCAAATCAGATCTCTCGGAAGAGGATGCGATTCTCGTCTCCATCAGCTACAGAGATCCTCACTCTAAGAAT
ATCACAGAATCAACGAATCGCAACTGCCGCTCGCGTCCATCAATCACCATCACTCTATGGAAAAATCGATTCGAAAATCG
TTCGTACGTATCCACGAGTCACCATCAAGGATATTCGTCTCCGACGCATCTTCTCTCCAACTCCGATCTCCACCGACTGC
GAATGTAACGGCAAAGGTAATGTAGATGGAGATAATTTTCGGCAAACGACGCCACCGGATTCCGAATTGTTAAGCAGTGT
ACCTATCCGTGAAGATATCAATGGATCAGCAGTGAAGAAAAGTGATACTAATTTATGTAGCAAATCGGTTCTCCATCCAT
GTTCTCGACCTAAGATATTCAAGAACACTGGTTCTTTTAGCTATAAGAGATTGCTTCCATACTTGATGCAAGCTTCTGAT
GATGGAACATCATCAAGCCAGTGCTCAAAACCTTTAAGCCAGAATCCTCCAAGTATGAGTTTGTCTTGTAACAAAGAAAC
TGGGGAAACTGTTGAAGATCTAAAGGAGGAATCGGACAGGGTGTTCGATAAAGATTCAGCCGGAAGCTTATGTGGGAACA
CCAGCCCTTTGACGAGGGTTAATGCATCCCTCCCCAACAAGAGAGCTGCATGCTCTAAGCGCAAGCTATTTAAGACACCA
GGTTCTGTTAATTACAGAAGAATGCTTCCATATCTCAAAGATATTCAAGAAGATAATCCTTTTGATCATCAAAAGAACAC
AGAAGAGGTAACTCCATCATCGATGTTAATCTCTGAGAATGAAGGGACACAGGAAGTGGTGACATCCAATGTTACTAGAG
AATCAGATATATGCTCTAATAAAAACGAGGAGCCCCTTTCTTGTGAACGTCTATCTGTATTTCCAGAACAGTCTGATCCT
GACAAAGAACAAGAAACACAGATTAAGCATGTCATCTCAGATACTGAAAATAATTTGGGCTCTGAGATCCCATTATCATC
TCCTCTAGTTGGTTCAAGAAGTTCAAGTGAAGTTGCTTCATCTGCTTTGCACAACACATTTCTCGACAATTTGGTGGGCG
AAGGAAACATGAATGGTGCAGAGATCACAGAAGCAAAAACCAGTGTAGAGCAACTAGAGGCAAATACATCAGATGCAACA
GCTGAACTGATTGACCCTTCTGTTATATTGGCAACTCCTCCCTCTATTTCTCCCTCGAAAGGAATTCTGAAAAGAAGTAT
GAGAGGATGTAGAGGGATATGCTCTTGTTTGAACTGCTCCTCCTTCCGTCTAAACGCAGAAAGAGCATTTGAATTCTCAA
GAAATCAGTTACAAGATACTGAAGTAATGGTTCTGGATCTAGTTGGAGAAATATCTCATCTCAGGGATATGTTGGAGAAA
TATAAATCAGAAGATCACAGTGAATCCTACAAAAGTCAGGCTGGAGAAGCTGCAAAGAGAGCTTGTGAGGCTGCAGAGCT
TGCAAAAAGCCGTCTCCATCAGATGAACGATGATTATCAAGTTCATTGCAGAATCCCCAACGAACAACGAGCAAGAGTGA
AATTTGCTCATTATGTACACGAGAAGACGATGAACCTACCAAATTGA