Details for Lyrate rockcress Locus 16042578

Position : sca3 ( 5`- 5062881 .. 5063636 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042578

Protein [Map View]
MSSSLTIFFFFASTFLYSSSNSFNITNILNEHDDFSTFNQLLSETQLASTINKRQTITVLVVSNGALSSISGQPTAVIKK
ILSLHIVLDYYDQKKLKNLSKKSVLLTTLFQSSGLARGQQGFLNATVTKDGDVAFGSAVPGSSLDAQLQDTVASLPFNIS
VLHISSAIMIDVKGDNAPTASPLSPVSSPPRPAESPKDDGHDFDEPPSSAPDAAADGPSENAGSANGVSRIDSQPAFTFP
LLMSSIWWFMA*

DNA
ATGTCTTCTTCACTTACAATCTTCTTCTTCTTTGCTTCCACATTCCTCTACTCTTCATCAAATTCATTCAACATCACTAA
CATCTTAAACGAGCATGATGATTTCTCAACTTTCAACCAGCTTCTCTCCGAAACTCAGCTCGCTTCTACCATCAACAAAC
GTCAAACCATAACCGTCCTCGTGGTTTCCAACGGCGCACTCTCTTCTATCTCCGGCCAACCAACCGCCGTTATCAAGAAA
ATCCTTAGCCTCCACATCGTTTTAGATTACTATGACCAGAAGAAACTCAAGAATCTGAGCAAGAAATCAGTACTCCTCAC
CACTCTTTTCCAATCTAGCGGCCTAGCCAGAGGCCAGCAAGGGTTCTTGAACGCAACCGTTACGAAAGACGGAGACGTGG
CGTTTGGATCTGCGGTTCCTGGGTCTAGCCTTGATGCTCAGCTTCAAGACACTGTAGCGTCACTACCATTTAACATCTCG
GTGCTTCATATTAGTAGTGCTATAATGATTGATGTTAAAGGTGATAATGCACCTACTGCTTCTCCTTTGTCACCGGTATC
ATCTCCACCGCGCCCTGCAGAATCACCTAAGGATGATGGTCATGATTTTGACGAGCCACCATCCTCTGCTCCTGATGCTG
CTGCTGATGGACCTTCCGAAAACGCCGGCTCAGCCAATGGAGTTTCAAGGATCGATTCTCAGCCTGCGTTCACGTTTCCG
CTGTTGATGTCTTCCATTTGGTGGTTCATGGCTTGA