Details for Lyrate rockcress Locus 16042528

Position : sca3 ( 5`- 944524 .. 945216 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042528

Protein [Map View]
MHYQEQMESLMLGEERRRGNYVRDADADADADEGVNSPSSFPNSPDDSDRRTSSSSSRRGLSKHYKGKSQSFTTLAEALT
VEDLAKPENPFNAKLKQRRESPHCRRLSGCGGASERNLSGHDVFLAGNDGPQRLPGNRPPLRAQTLSAAHISALLTRT*

DNA
ATGCACTATCAAGAACAGATGGAGTCGCTTATGTTGGGAGAAGAACGCAGACGCGGAAACTACGTCAGAGACGCAGACGC
GGACGCGGACGCAGATGAAGGTGTTAACTCTCCCTCTTCTTTTCCAAACTCTCCTGATGATTCGGACCGTCGCACTTCTT
CTTCTTCTTCAAGGAGAGGATTGTCGAAACATTACAAAGGTAAATCACAATCGTTCACAACGTTGGCAGAAGCGCTAACT
GTGGAAGATCTCGCTAAGCCCGAGAATCCATTCAACGCAAAGCTGAAGCAGCGACGAGAGAGCCCTCACTGTCGTAGATT
ATCCGGATGCGGCGGCGCTTCGGAGCGAAATTTAAGTGGTCACGACGTTTTTCTCGCCGGAAACGATGGGCCGCAGCGAC
TCCCCGGTAACAGACCGCCTCTGAGAGCCCAGACGCTCTCGGCGGCTCATATTTCGGCTTTGCTTACTCGAACCTAA