Details for Lyrate rockcress Locus 16042505

Position : sca3 ( 5`- 5132344 .. 5131946 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042505

Protein [Map View]
MKQLIRRLSRVADSAQYSLLRSDSQRPSRRSESFLRSSVSRRSKKQTSSVPEGHVPVYVGDEMERFVVSAELLNHPVFIG
LLNRSAQEYGYEQKGVLQIPCHVLVFERIMESLRLGLPVPIDVQDLIGDEAN*

DNA
ATGAAGCAACTGATCCGCCGTCTCTCTCGCGTCGCTGATTCCGCTCAATACAGTCTCCTCCGCTCCGATTCACAACGACC
TAGCCGCCGTTCCGAATCATTCCTCCGTTCTTCGGTGTCTCGCCGCTCAAAGAAGCAGACCTCTTCGGTTCCTGAAGGAC
ACGTACCGGTCTACGTAGGTGACGAGATGGAGAGGTTCGTCGTTAGCGCCGAGCTACTTAACCATCCGGTTTTCATCGGT
TTACTAAACCGATCTGCTCAAGAGTATGGATACGAGCAAAAAGGAGTGCTACAAATCCCTTGCCATGTACTTGTCTTCGA
ACGAATCATGGAATCGCTTCGTCTTGGACTTCCGGTGCCGATTGATGTTCAGGATCTAATCGGCGACGAGGCGAATTGA