Details for Lyrate rockcress Locus 16042503

Position : sca3 ( 5`- 661570 .. 660650 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042503

Protein [Map View]
MNHCSLQQNAFMSRDESRGFVPIYCYPMDYVVCPKPRRANNVIRPLRLHFSQSGADDVSDSKAGEDLLDIFRRKESVSST
SPPFFLGSPPSRAANPLAQDARFGDEKLITVSPSLSPRVKAGGGGCGRMKFGVKPATVRVEGFDCLNRDRQNSSIPAVA*

DNA
ATGAATCATTGTAGCCTTCAGCAGAACGCCTTCATGTCTCGTGACGAATCGAGAGGATTTGTTCCTATCTATTGTTATCC
AATGGACTATGTTGTTTGTCCTAAGCCTCGTCGTGCCAACAACGTTATTCGTCCCCTTAGATTACATTTTAGTCAATCAG
GAGCTGATGATGTATCTGATTCTAAAGCCGGGGAAGATCTTTTGGACATATTTCGTAGAAAGGAATCAGTATCATCTACG
TCACCCCCATTTTTTCTTGGGTCTCCCCCGAGCCGAGCAGCAAACCCGTTAGCTCAAGATGCACGCTTTGGAGATGAGAA
ACTCATCACTGTCTCACCCTCACTCTCCCCTCGTGTTAAAGCAGGAGGAGGAGGTTGTGGTAGAATGAAGTTTGGGGTGA
AACCAGCAACTGTTAGAGTAGAAGGGTTTGATTGCTTGAACAGGGACCGCCAAAACTCAAGCATTCCTGCCGTGGCCTAG