Details for Lyrate rockcress Locus 16042498

Position : sca3 ( 5`- 3345725 .. 3341923 -3` )
Annotation : [B2G] protein binding protein
External links : CoGe
PGDD synteny : 16042498

Protein [Map View]
MAFHVACPITCRRICNCSLGFSRDLRGANAKEEFLKEVNRVEEFLKDPCVSSKVFDGGTVQVRVPKVVPAPQTVSILGVG
DGAIGSGVDELAEEASAQKKRVALQRQAAVTVEAAEDYARRFESGVNDLTSNDHAGEEVVHSGMNIMCRMCFLGEGEGSE
RARRMLSCKTCGKKYHKNCLKSWAQHRDLFHWSSWSCPSCRVCEVCRRTGDPNKFMFCKRCDAAYHCYCQHPPHKNVSSG
PYLCPKHTRCHSCDSTVPGNGLSVRWFLSYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDICQRWVHCHCDGISD
DKYLQFQVDGKLQYKCATCRGECYQVKDLQDAVQELWKKKDVVDKELIASLRAAAGLPTDEEIFSIFPFSDDDENGPVSG
RSLKFSIKGLVEKSPKKSKEYGKHSLSKKHASKKGSHTKLEPELHQEVGSERLRLGGVRIDNVGFQINEQSDVNSSVAGI
CSTHEPKIVKHKRVDDVMVTDEEKPSRIVRIKCSKPHDSDSEDTLRNAGEEKSVKAKKLVINLGARKINVSGSSKSNVVS
HLSRDKDQSTLGGDKVDQTGEVRTLKISGRFGKTQSEGSKATFGSITQFPASTSEGNHVDDKTSISPALQKEARPLLKFK
LRKPNSGDQTSSVTTQSEDEKLSSAKGQRSKRKRPSSLVDMASLKEDGEATTHSHQDSSRNDEMMDANWILKKLGKDSIG
KRVEVHGSQNSWHKGTVTDVSGDTSTLSVSLDDGSIKTFELGKHSVRFIPQKQKRSRS*

DNA
ATGGCCTTTCACGTAGCTTGCCCAATTACATGTCGTCGGATCTGCAATTGCTCCTTAGGGTTTTCTCGGGATCTCCGTGG
AGCCAATGCGAAAGAGGAGTTTTTGAAAGAGGTTAATCGAGTGGAGGAGTTTCTCAAGGATCCTTGTGTTTCTTCTAAGG
TTTTTGATGGAGGTACCGTTCAGGTTAGGGTTCCTAAGGTTGTTCCTGCTCCTCAGACGGTTTCGATTTTGGGGGTTGGA
GATGGTGCTATTGGTTCGGGAGTTGATGAATTGGCGGAGGAAGCTTCGGCTCAGAAGAAACGTGTTGCTCTTCAGAGACA
AGCTGCTGTTACGGTTGAAGCTGCTGAGGATTATGCTCGGAGGTTTGAATCTGGGGTCAATGACCTTACCTCAAACGATC
ATGCTGGTGAAGAAGTAGTTCACTCCGGCATGAATATAATGTGCAGAATGTGCTTTCTAGGAGAAGGTGAAGGAAGTGAG
AGAGCAAGGAGAATGCTTTCCTGTAAAACCTGTGGAAAGAAGTATCACAAGAATTGTTTAAAGTCTTGGGCTCAACATAG
AGATTTATTTCATTGGAGTTCATGGAGTTGTCCCTCTTGCCGGGTTTGTGAGGTCTGCCGTAGAACAGGAGATCCTAACA
AATTCATGTTCTGCAAAAGGTGTGATGCTGCTTACCATTGTTATTGCCAACATCCTCCACACAAGAATGTAAGTTCTGGG
CCATATCTCTGCCCAAAGCATACAAGATGCCACAGCTGTGATTCTACTGTCCCTGGAAATGGCCTAAGTGTCAGGTGGTT
TTTATCATATACTTGCTGTGATGCTTGTGGCAGATTGTTTGTGAAGGGAAATTATTGCCCTGTATGCTTGAAGGTGTATA
GGGATTCGGAATCAACCCCAATGGTATGCTGCGATATTTGTCAACGCTGGGTGCATTGCCATTGCGATGGAATAAGTGAT
GACAAATATCTGCAGTTTCAAGTTGACGGAAAGCTACAATATAAATGTGCCACATGCCGTGGGGAGTGTTATCAGGTGAA
GGATCTTCAGGATGCAGTTCAAGAACTTTGGAAGAAAAAAGATGTGGTGGACAAAGAGTTGATTGCTAGTTTAAGGGCTG
CTGCTGGTTTGCCAACAGACGAGGAAATATTTTCGATATTTCCATTTTCAGATGATGATGAAAATGGACCCGTATCTGGG
CGCTCACTGAAGTTTTCTATTAAAGGTTTGGTGGAAAAATCCCCAAAGAAAAGCAAGGAGTATGGGAAACACTCTTTAAG
TAAAAAGCATGCTAGTAAAAAAGGTAGTCACACTAAGTTAGAGCCTGAACTTCATCAGGAGGTTGGATCTGAGAGACTCC
GACTAGGTGGTGTTAGAATTGATAATGTGGGGTTTCAGATAAACGAACAATCAGACGTTAATTCTTCTGTAGCTGGAATT
TGCTCAACACATGAACCTAAGATTGTAAAACACAAGAGGGTTGATGATGTTATGGTGACTGATGAAGAAAAGCCATCAAG
GATAGTCAGAATAAAGTGTAGCAAGCCTCATGATTCTGATAGCGAGGATACCCTAAGGAATGCAGGGGAGGAGAAATCTG
TAAAGGCAAAGAAGTTGGTTATTAATCTGGGTGCTAGGAAAATAAATGTCAGTGGTTCTTCGAAGTCCAATGTGGTTTCT
CATTTATCGAGGGACAAAGATCAGTCCACTTTGGGTGGAGATAAAGTTGATCAGACTGGCGAAGTAAGAACCCTGAAGAT
CTCTGGAAGGTTTGGGAAAACTCAATCTGAAGGAAGTAAAGCTACATTTGGTTCGATCACACAGTTCCCTGCATCAACAA
GTGAAGGAAATCATGTGGATGACAAAACATCCATCTCACCAGCATTACAGAAAGAAGCAAGACCTCTGCTGAAATTTAAA
CTCAGGAAACCTAATTCAGGAGATCAGACATCTTCGGTTACAACGCAGTCTGAAGATGAAAAACTGAGTTCTGCGAAGGG
CCAAAGATCAAAGAGAAAGAGACCTTCAAGCTTAGTGGACATGGCTTCATTGAAAGAGGACGGTGAAGCTACAACACATT
CTCATCAGGATAGTTCAAGGAACGACGAGATGATGGATGCTAACTGGATTTTGAAAAAGTTGGGTAAAGATTCAATAGGA
AAGAGAGTCGAAGTCCATGGATCTCAAAACTCATGGCATAAGGGAACAGTGACAGATGTTTCTGGAGACACATCCACATT
GTCGGTTTCTCTAGATGATGGAAGCATCAAGACATTTGAACTTGGGAAGCACAGTGTCCGCTTCATACCGCAAAAGCAAA
AGAGGTCGAGGAGCTGA