Details for Lyrate rockcress Locus 16042496

Position : sca3 ( 5`- 11723985 .. 11725532 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_899015 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16042496

Protein [Map View]
MSARHGQSSYRDRTKEFIDIVESLRRSIAPAANIVPYGNNRNDGSRREDLINKSEFNNRASKIGLAINQTSQKLSKLAKL
AKRTSVFDDPTQEIQELTVVIKQEISALNTALLDLQVLRSSQNGEENNSRDTSTHSTTVVDVLKNRLMDTTKDFKDVLTM
RTENMKIHENRRQLFSSNASKESTNPFVRQRPLAAKAAASESAPLPWANGSSSSSSQLVPWKQGEGESSPLLQQSQQQQQ
QQQQMVPLQDTYMQSRAEALHNVESTIHELNSIFTQLATMVSQQGEIAIRIDQNMEDTLANVEGAQSQLARYLNSISSNR
WLMMKIFFVLIAFLMIFLFFVA*

DNA
ATGTCGGCAAGGCATGGGCAATCGTCGTATCGAGATCGAACGAAGGAATTCATCGATATCGTTGAGAGTCTAAGGAGATC
GATTGCTCCGGCGGCGAATATTGTACCGTATGGTAATAATAGGAACGATGGTTCGAGAAGAGAGGATCTTATCAACAAAT
CCGAGTTCAACAATAGAGCTTCTAAGATTGGTTTAGCAATTAATCAGACGTCGCAGAAGCTTTCGAAGCTAGCGAAACTT
GCAAAGAGGACATCAGTTTTTGATGATCCGACTCAGGAGATACAAGAGCTGACAGTAGTCATTAAGCAAGAGATCTCTGC
TCTAAATACTGCTCTGCTTGACCTTCAAGTGCTTCGTAGCTCCCAGAATGGCGAAGAGAACAATTCTAGAGACACATCAA
CTCACTCAACAACAGTTGTTGACGTTCTAAAGAATCGCCTGATGGATACTACCAAAGATTTTAAGGATGTTCTTACTATG
AGGACCGAGAACATGAAGATCCATGAGAATCGAAGGCAACTCTTCTCTTCAAATGCTTCTAAAGAATCAACAAACCCGTT
TGTTCGCCAGCGGCCTTTGGCTGCTAAGGCTGCTGCTAGTGAATCTGCTCCTCTTCCATGGGCGAATGGGTCTTCTTCAT
CGTCATCTCAGTTAGTCCCATGGAAGCAGGGAGAGGGCGAATCTTCACCATTGTTGCAGCAGAGTCAACAACAACAACAG
CAACAGCAGCAAATGGTCCCATTGCAAGACACATATATGCAGAGCCGAGCCGAAGCTCTACACAACGTTGAATCAACAAT
CCATGAGCTAAACAGTATCTTCACACAACTAGCAACCATGGTTTCTCAACAAGGGGAAATTGCTATCAGGATCGATCAAA
ACATGGAAGATACATTAGCGAATGTGGAAGGCGCACAGAGCCAACTGGCCAGGTATCTCAACAGCATATCGTCAAACCGA
TGGCTGATGATGAAGATTTTCTTCGTACTCATTGCATTTCTCATGATTTTCCTCTTCTTCGTGGCGTAA