Details for Lyrate rockcress Locus 16042495

Position : sca3 ( 5`- 5700225 .. 5701034 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042495

Protein [Map View]
MPSGKPSSVFPLHPKPTPLKPSSSSTSNTNSSTNQACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKI
IKSLTPPEKDAAMHTIMFQSDARASDPVDGCYGIIRKLQYQIEYTRNELEIVLQQLAMFRDRAHHHHQEPQIQMQEPEDL
SSFSSSCDINNNNSIPYNYALNHIQEPNQQQQQYCSSGNNFNGLQEDMWCLQLQDSSTTVNMKAGFIDECEDVKPVEEVS
SERHEFEPHEAFVEQRKLDLPPAQFIISS*

DNA
ATGCCCTCAGGCAAACCTTCTTCTGTATTCCCTTTACATCCCAAACCAACACCATTAAAACCTTCTAGCAGCAGCACCAG
CAACACCAATAGCAGCACAAACCAAGCCTGCGCCGCCTGCAAATACCAACGCAGGAAATGCGCTCCCGATTGTCTTCTCG
CTCCTTATTTCCCTCACGACCGTCACCGCCAATTCCTTAACGCGCATAAGCTCTTTGGAGTCAGCAACATCACCAAGATC
ATCAAATCCCTTACCCCTCCTGAGAAAGACGCAGCTATGCATACAATCATGTTTCAATCCGATGCTCGTGCCAGTGATCC
TGTTGATGGATGCTATGGCATCATAAGAAAGCTTCAATACCAGATCGAATACACCAGAAACGAATTGGAGATTGTTCTTC
AGCAATTGGCTATGTTCCGTGACCGTGCTCATCATCATCATCAAGAACCGCAAATCCAGATGCAAGAACCAGAGGATCTC
TCAAGTTTTTCGAGTTCTTGTGATATAAACAACAACAACTCGATTCCTTACAATTACGCTCTGAATCACATTCAAGAACC
AAATCAACAACAACAACAATATTGTTCTTCCGGTAATAACTTCAATGGGTTACAAGAAGACATGTGGTGTCTTCAACTTC
AAGATTCATCAACGACAGTGAATATGAAGGCTGGTTTCATTGATGAATGTGAAGACGTTAAGCCTGTGGAAGAGGTTTCT
AGCGAAAGACACGAGTTCGAGCCTCATGAAGCTTTCGTTGAACAACGGAAACTCGACTTGCCTCCAGCACAATTCATCAT
TTCTTCTTAG