Details for Lyrate rockcress Locus 16042450

Position : sca3 ( 5`- 9053959 .. 9054714 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042450

Protein [Map View]
MDREEELGRKCCTCCLKFIFTAGLGALILWLSLRAGKPKCSIQNFYIPALSKNLSSRDNTTLNFMVRCDNPNRDKGIYYN
DVHLIFSTINTTKTNSSALVLVANYTVPKFYQGHKKKAKKWGQVKPLNNQTVLRAVLPNGSAFFRLDLKTQVRFKIVFWK
TKWYRRVEVGADVEVNGDGVKANEKEIMMKKSDFWKTQGYWSDFGADDVDLTGDGAQNKGSKMKKSDSSLPLRSSFPICV
LMNLLVFFAIR*

DNA
ATGGATAGAGAAGAAGAACTTGGTCGAAAATGTTGTACTTGCTGCTTAAAGTTCATCTTCACAGCTGGTCTCGGCGCTCT
TATCTTATGGCTTAGTCTCCGTGCCGGCAAACCCAAATGCTCAATCCAAAACTTTTACATTCCTGCCCTCAGCAAAAACC
TAAGTTCACGAGACAATACCACTCTAAATTTCATGGTTCGTTGTGACAATCCAAATAGAGACAAAGGAATCTACTACAAC
GATGTCCACCTTATTTTCTCCACCATCAACACGACCAAGACCAATTCATCTGCTCTTGTCTTAGTTGCTAACTACACAGT
GCCTAAGTTCTATCAAGGACACAAGAAGAAGGCCAAGAAGTGGGGTCAAGTAAAGCCGCTAAACAACCAAACCGTTTTAC
GAGCGGTTTTGCCTAATGGATCGGCTTTTTTCAGGTTGGATCTCAAGACTCAAGTGAGATTCAAGATTGTTTTTTGGAAA
ACTAAATGGTATAGGAGAGTGGAAGTTGGTGCTGATGTTGAAGTCAACGGTGATGGAGTTAAAGCTAATGAGAAAGAGAT
TATGATGAAGAAATCTGATTTTTGGAAAACTCAGGGATATTGGAGTGACTTTGGTGCTGACGATGTTGATCTCACCGGTG
ATGGAGCTCAAAATAAAGGAAGTAAGATGAAGAAATCTGATTCTTCTTTACCATTAAGAAGCTCTTTTCCGATTTGTGTT
TTAATGAATTTGCTCGTATTCTTCGCTATTCGTTAA