Details for Lyrate rockcress Locus 16042448

Position : sca1 ( 5`- 7769931 .. 7773666 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_472070 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16042448

Protein [Map View]
MASSLLRNPNLYSSTTITTAPFLPTVSSNPTPVSSFRFQPSHHRSISLRSQTLRLSCSISDPSPLPPHTPRRRRPEYIPN
RISDPNYVRVFDTTLRDGEQSPGATLTSKEKLDIARQLAKLGVDIIEAGFPAASKDDFEAVKTIAETIGNTVDENGYVPV
ICGLSRCNKKDIERAWDAVKYAKRPRIHTFIATSDIHLEHKLKKTKAEVIEIARNMVRFARSLGCEDVEFSPEDAGRSER
EYLYEILGEVIKAGATTLNIPDTVGITLPNEFGQLITDLKANTPGIENVVISTHCQNDLGLSTANTLSGAHAGARQVEVT
INGIGERAGNASLEEVVMAIKCRGDHVLGGLFTGIDTRHIVMTSKMVEEYTGMQTQPHKAIVGANAFAHESGIHQDGMLK
HKGTYEIICPEEIGLERSNDAGIVLGKLSGRHALKDRLTELGYQLDDEQLSTIFWRFKTVAEQKKRVTDADIIALVSDEV
FQPEAVWKLLDIQITCGTLGLSTATVKLADTDGREHVACSIGTGPVDSAYKAVDLIVKEPATLLEYSMNAVTEGIDAIAT
TRVLIRGSNKYSSTNAITGEEVQRTFSGTGAGMDIVVSSVKAYVGALNKMMDFKENSPTKIPSQKNRVPA*

DNA
ATGGCGTCTTCGCTTCTGAGAAACCCTAATCTCTACTCATCAACAACAATCACCACCGCTCCTTTTCTTCCCACCGTCTC
CTCTAACCCCACACCTGTCTCCTCCTTCCGTTTCCAACCATCCCACCACCGTTCAATCTCCCTCCGAAGTCAAACCCTCC
GTCTCTCATGCTCAATCTCAGATCCTTCTCCACTACCACCTCACACTCCTCGCCGCCGCCGTCCTGAATACATCCCTAAC
CGCATTTCCGATCCAAACTACGTCCGTGTCTTCGATACAACTCTCCGTGACGGTGAACAGTCTCCAGGAGCTACACTCAC
TTCCAAGGAAAAGCTCGACATCGCTCGTCAGCTAGCTAAACTCGGTGTTGACATTATCGAAGCTGGGTTTCCAGCTGCTT
CTAAGGATGATTTTGAAGCGGTTAAGACTATAGCTGAAACAATTGGAAACACTGTTGATGAGAATGGTTATGTTCCTGTT
ATCTGTGGACTCTCTAGATGCAATAAGAAGGATATTGAGAGGGCTTGGGATGCTGTCAAATACGCTAAACGGCCTAGGAT
TCATACTTTTATCGCTACGAGTGATATTCATTTGGAGCATAAACTGAAGAAAACCAAAGCAGAGGTCATCGAAATCGCTA
GGAATATGGTTAGATTCGCGAGAAGCTTAGGCTGCGAAGATGTCGAGTTCAGTCCAGAAGATGCAGGAAGATCGGAGAGG
GAGTACTTATACGAGATTCTTGGTGAAGTGATTAAAGCAGGAGCAACAACACTGAATATACCTGATACTGTTGGTATAAC
TTTGCCTAATGAGTTTGGTCAATTGATTACTGATTTAAAGGCCAATACTCCAGGGATTGAAAATGTTGTCATCTCAACAC
ATTGTCAGAATGATCTTGGACTCTCTACGGCCAACACTTTATCTGGGGCACATGCAGGTGCCAGGCAGGTGGAAGTGACG
ATCAATGGAATCGGGGAAAGAGCTGGAAATGCTTCACTGGAAGAGGTTGTGATGGCCATAAAATGCCGTGGAGATCATGT
ATTAGGAGGTCTATTTACCGGAATTGATACTCGGCACATTGTTATGACAAGCAAGATGGTGGAAGAGTACACAGGAATGC
AGACACAGCCACATAAGGCTATTGTAGGAGCGAATGCCTTTGCGCATGAAAGTGGTATCCATCAGGATGGAATGCTAAAA
CACAAGGGTACATATGAAATTATATGTCCCGAAGAAATTGGACTTGAACGATCAAATGATGCTGGCATTGTCTTGGGGAA
GCTTAGTGGGCGTCATGCGCTGAAAGACCGTTTGACTGAGCTTGGTTATCAATTAGATGATGAACAGCTAAGTACCATTT
TCTGGCGTTTCAAAACTGTGGCTGAGCAGAAAAAGAGAGTTACCGATGCGGACATAATAGCTTTAGTATCTGATGAAGTT
TTCCAGCCAGAAGCCGTGTGGAAACTCCTGGACATTCAGATAACTTGTGGAACTCTCGGGCTTTCAACAGCAACTGTAAA
ACTTGCTGACACTGATGGCAGAGAACATGTCGCTTGTTCCATTGGAACTGGGCCTGTCGATTCAGCTTACAAGGCAGTCG
ATCTTATCGTAAAGGAACCTGCGACCCTGCTTGAGTACTCAATGAATGCAGTAACAGAAGGGATCGATGCCATCGCAACC
ACACGAGTTCTTATCCGTGGAAGCAACAAGTACTCATCTACAAATGCAATAACTGGTGAAGAGGTTCAAAGGACCTTTAG
TGGAACTGGAGCAGGAATGGATATTGTGGTGTCAAGCGTCAAAGCTTATGTAGGAGCCTTGAACAAAATGATGGACTTCA
AAGAAAACTCCCCCACAAAAATCCCTTCCCAAAAAAACAGAGTCCCTGCCTGA