Details for Lyrate rockcress Locus 16042390

Position : sca3 ( 5`- 6157910 .. 6156804 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16042390

Protein [Map View]
MDAQYQDLPPLKRLRLMQRDLEAAQQQQLLNQPEAKSLQLPAKKRKQTRVDYDDDAENSNPTYHCLPAKKRIWAIDPDLL
SGNPFSPFDLNVEYKPPSVEEKSIEKKSTLMVESSLEVEDDDDDKENVDPLGKEKVLDLSDREVEDEDGIMCVVCQSTDG
DPSNPIVFCDGCDLMVHASCYGNPLVKAIPEGDWFCRQCISSKNREKLFSCCLCTTKGGAMKPTNDGRWAHITCALFVPE
VYFEDPEGREGICCREIPSKRWKDRCYLCKVRRGCVIECSEMRCKLAFHVTCGLKEDLCIEYREDKKSGGIVVGFCNEHT
KLWERQQESGKYKIVARDEDKK*

DNA
ATGGATGCTCAATATCAAGATCTACCTCCTCTCAAAAGATTAAGACTGATGCAGCGAGATCTCGAAGCTGCGCAACAACA
ACAGCTACTGAACCAACCGGAGGCGAAGTCGTTGCAGTTGCCTGCGAAGAAGAGGAAGCAGACTCGTGTTGATTACGACG
ACGATGCCGAGAACTCCAATCCCACCTATCATTGTCTTCCGGCGAAGAAAAGGATTTGGGCGATTGATCCTGATTTGCTC
TCCGGTAATCCTTTTTCGCCTTTTGATCTGAATGTTGAGTATAAGCCTCCTTCCGTTGAGGAGAAGTCAATTGAGAAAAA
GTCAACTCTAATGGTTGAATCTAGTCTAGAGGTAGAAGATGATGATGATGATAAAGAGAATGTAGATCCTCTAGGGAAAG
AAAAAGTTTTAGATCTCTCAGATAGAGAAGTAGAAGATGAAGATGGGATTATGTGTGTTGTATGTCAAAGCACAGATGGT
GATCCATCGAATCCAATAGTGTTCTGTGATGGTTGTGATTTGATGGTTCATGCTTCTTGCTATGGGAATCCTCTGGTTAA
GGCTATACCAGAAGGTGATTGGTTTTGTAGACAGTGTATATCATCGAAGAATCGAGAAAAGCTTTTCTCTTGCTGTTTGT
GTACAACTAAAGGCGGAGCGATGAAACCTACTAATGATGGTCGATGGGCTCATATTACTTGCGCGTTGTTTGTGCCTGAA
GTTTACTTTGAGGATCCTGAAGGAAGAGAAGGGATTTGTTGTAGGGAGATACCGAGTAAGAGATGGAAAGATAGGTGTTA
TTTGTGTAAGGTTAGACGCGGTTGTGTTATCGAGTGTTCGGAGATGAGATGTAAGTTGGCTTTTCATGTTACTTGTGGGT
TGAAGGAAGATCTTTGCATTGAGTATCGTGAAGACAAGAAGAGTGGTGGTATTGTTGTTGGTTTCTGCAATGAGCATACC
AAACTATGGGAAAGGCAACAGGAAAGTGGAAAGTACAAGATTGTTGCCAGAGATGAAGATAAGAAGTAA