Details for Lyrate rockcress Locus 16042381

Position : sca3 ( 5`- 5924107 .. 5923107 -3` )
Annotation : [B2G] protein binding protein
External links : CoGe
PGDD synteny : 16042381

Protein [Map View]
MNDGSSSSSTKVDTDVLVDETYFSALFDYDEVFPISDENYATELHLQEALFSSIVASTGGVNHHPQVQRNLVTRVKQEPE
IKTENEPTEPSRRFCMICMDEKPSSDIFRGTTNCVHFYCTDCTVRYVATKIKENAARIKCPDVECTHLIEPYTCRDLIPK
DVFDRWDKILCESLISSWDKFYCPFKDCSAMMVNDEGGNANVTQTECPSCHRLFCVKCKVTWHAGIGCDEFQRFGNTKKK
SSDDEDALLIQMAKNKQWRRCPSCKFYVDKVEGCQHINCRCGYQFCYGCGSVWGSSHVCQIRY*

DNA
ATGAATGATGGTTCATCATCATCAAGCACAAAGGTGGACACCGATGTGTTGGTAGATGAAACCTACTTCTCTGCTTTGTT
CGATTACGATGAAGTTTTCCCAATCTCCGACGAAAACTACGCTACGGAGCTCCATCTCCAAGAAGCTCTGTTTTCTTCCA
TTGTCGCTTCTACTGGTGGTGTTAATCATCATCCCCAAGTCCAAAGGAATCTCGTCACGCGGGTTAAGCAGGAACCGGAG
ATCAAAACCGAGAATGAACCCACCGAACCATCGAGAAGGTTTTGTATGATCTGTATGGACGAAAAACCTTCCTCCGACAT
CTTCCGAGGAACCACTAACTGTGTTCACTTCTACTGCACAGACTGCACCGTCCGGTACGTGGCGACTAAGATCAAAGAAA
ACGCAGCGAGGATCAAATGTCCTGACGTGGAGTGCACGCACCTGATAGAGCCATACACGTGTCGAGATCTAATCCCCAAG
GACGTTTTCGACCGTTGGGATAAAATCTTGTGCGAGTCTTTGATCTCCTCGTGGGACAAATTCTACTGTCCGTTCAAAGA
CTGTTCGGCTATGATGGTGAACGATGAAGGTGGTAATGCAAACGTGACGCAGACGGAGTGTCCGTCTTGTCACCGACTCT
TCTGTGTGAAGTGTAAGGTGACGTGGCATGCGGGGATTGGGTGTGACGAGTTCCAGAGATTTGGGAATACGAAGAAGAAG
AGTAGTGATGACGAAGATGCTTTGTTGATTCAGATGGCGAAAAATAAGCAGTGGAGAAGGTGTCCTAGTTGCAAATTCTA
TGTTGATAAAGTTGAAGGTTGTCAACATATAAATTGCAGGTGTGGATATCAGTTTTGCTATGGTTGTGGATCTGTGTGGG
GTTCTTCTCACGTATGCCAAATCCGTTACTAA