Details for Lyrate rockcress Locus 16042362

Position : sca2 ( 5`- 15870726 .. 15873836 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042362

Protein [Map View]
MRISGHSIIAISFFILSVYIHRVQARPFVLVLSNDDFNGGFDDNGAEESSNFDEFGESEPKSEEELDPGSWRPIFEPNDS
AVHASASPQYYSGLHKILSAAIEGNSTLMEEAVSEIDSCASSGDPHAQSVMGFVYGIGMMRETSRSKSILHHHFAAEGGN
MQSKMALAFRYLRQNMHDKAVELYAELAETAVNSFLISKDSPMVEPVRIHIGTEENKDALRKSRGKEDEDFQILEYQAEK
GNSAAMHKIGLFYYFGLRGLRRDHAKALYWFSKAALECLTLAVKHGLHSAFNGLGYLYVKGYGVDTRNYTKAKEYFEMAA
NSEDPSGHYNLGVLYLKGIGVKKDVRRATKYFFVAANAGQPKAFYQLAKMFHTGVGLTKNLEMATTFYKLVAERGPWSSL
SRWALEAYSKGDVGKAFILYSRMSELGFEVAQSNAAWILDKYGERSMCMGVSGFCTDKERHDRAHSLWWRASEQGNEHAA
LLIGDAYYYGRGTERDFVRAAEAYMYAKSQSNAQAMFNLGYMHEHGEGLPFDLHLAKRYYDQALQSDAAAKLPVTLALAS
VWVRRNYADTALVQVLDSVPEVYRKVEEWVENVVLEEVVLDPVGADVAQPLAGPVAFPQ*

DNA
ATGAGAATCTCAGGTCACAGTATCATAGCCATCTCTTTCTTCATACTCTCAGTCTACATTCATCGCGTTCAAGCCCGTCC
CTTCGTTCTCGTTCTCTCCAACGACGATTTCAACGGCGGCTTTGATGATAACGGTGCCGAAGAATCCTCTAATTTCGATG
AATTCGGAGAATCCGAACCCAAATCCGAAGAGGAGCTTGATCCCGGTTCCTGGCGACCAATCTTCGAGCCAAATGATTCC
GCCGTCCACGCCTCTGCGTCGCCGCAGTACTACTCCGGACTCCACAAAATCCTCTCGGCGGCGATTGAAGGAAACAGTAC
ATTGATGGAGGAAGCGGTTTCAGAGATAGATTCGTGTGCCTCTTCGGGAGATCCACACGCACAATCAGTGATGGGATTCG
TATACGGGATTGGGATGATGCGTGAGACGAGCCGAAGCAAATCGATTTTACATCATCATTTCGCTGCTGAGGGAGGAAAT
ATGCAATCGAAAATGGCACTTGCTTTCAGATATCTAAGACAAAATATGCATGATAAAGCTGTTGAGTTATATGCTGAACT
AGCAGAGACAGCAGTGAATAGCTTTCTGATTTCAAAGGATTCTCCAATGGTTGAGCCAGTTAGAATCCACATTGGAACAG
AGGAGAATAAAGATGCACTTAGGAAATCCCGTGGAAAGGAAGATGAGGATTTTCAGATATTGGAATACCAGGCAGAGAAA
GGGAATTCTGCGGCAATGCACAAAATTGGACTGTTTTATTACTTTGGTTTGAGAGGGCTAAGGCGTGATCATGCCAAGGC
GTTGTACTGGTTTTCGAAGGCGGCACTTGAATGTCTTACACTTGCGGTAAAACATGGTCTCCATTCGGCATTTAATGGCT
TGGGTTACTTGTATGTCAAAGGCTATGGAGTAGATACGAGAAACTACACTAAGGCGAAAGAATACTTTGAGATGGCTGCT
AATAGTGAAGATCCTAGCGGGCATTATAACCTTGGAGTGTTGTATCTTAAAGGCATTGGAGTCAAGAAGGATGTGAGGCG
TGCAACCAAATATTTCTTTGTTGCTGCCAATGCTGGTCAACCAAAGGCTTTTTATCAACTCGCCAAGATGTTCCATACGG
GCGTTGGGCTTACAAAGAACTTGGAAATGGCGACGACTTTTTATAAACTAGTAGCAGAAAGAGGACCATGGAGTTCTCTC
TCTAGATGGGCTCTTGAAGCCTACTCGAAAGGTGATGTGGGAAAGGCTTTTATATTGTATTCGAGAATGTCAGAGCTCGG
TTTTGAAGTAGCACAAAGTAATGCTGCCTGGATCCTCGATAAATATGGGGAAAGAAGCATGTGCATGGGAGTGTCTGGGT
TTTGCACAGATAAGGAGAGGCACGATCGGGCTCATTCTTTGTGGTGGCGTGCCTCTGAACAGGGAAACGAACATGCTGCA
TTGCTTATTGGAGATGCATACTACTACGGTCGGGGTACAGAGAGGGATTTCGTGCGTGCAGCAGAGGCGTACATGTATGC
TAAATCTCAATCAAATGCGCAAGCAATGTTCAACCTCGGTTATATGCATGAGCATGGAGAAGGTCTTCCTTTCGATCTCC
ATCTTGCTAAACGTTACTATGATCAGGCCCTCCAGAGCGATGCTGCTGCCAAATTGCCTGTCACACTAGCTCTTGCGAGT
GTATGGGTTCGCAGAAACTATGCTGATACTGCCCTGGTGCAAGTACTGGATTCCGTACCAGAAGTGTATCGAAAGGTGGA
GGAATGGGTAGAGAATGTGGTGTTGGAAGAAGTGGTTTTGGATCCCGTTGGTGCAGACGTGGCACAGCCCCTCGCTGGAC
CTGTAGCCTTTCCCCAGTAA