Details for Lyrate rockcress Locus 16042347

Position : sca3 ( 5`- 1668269 .. 1669099 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896526 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16042347

Protein [Map View]
MASLSFVSSSHLTLRTPSISLRSTGSSPRTSVSFSVKAQSVALSQDDLKKLAAEKAVEAIKPGMVLGLGTGSTAAFAVDQ
IGKLLSSGELYDIVGIPTSKRTEEQARSLGIPLVALDTHPRIDLAIDGADEVDPNLDLVKGRGGALLREKMVEAVAEKFI
VVADDTKLVTGLGGSGLAMPVEVVQFCWNFNLIRLQDLFKEFGCDAKLRVDGDGKPYVTDNSNYIIDLYFKNPLKDGFAA
AKEIGKFQGVVEHGLFLGMATSVIIAGKNGVQVMTK*

DNA
ATGGCTTCCTTATCCTTCGTTTCCTCTTCCCACCTTACGCTACGCACTCCTTCTATTTCCCTACGCAGCACTGGCTCTTC
TCCTAGAACCTCCGTTTCATTCTCCGTCAAGGCTCAATCCGTCGCGCTTTCACAGGACGATTTGAAGAAGCTCGCGGCGG
AGAAAGCTGTAGAGGCAATTAAACCTGGAATGGTTCTAGGTCTTGGAACCGGATCAACCGCAGCATTCGCCGTTGATCAG
ATCGGGAAACTACTCTCTTCCGGTGAACTCTACGATATTGTTGGTATCCCAACGTCGAAACGAACGGAGGAACAAGCACG
ATCGTTAGGGATTCCTCTTGTTGCGTTAGATACGCATCCGAGAATCGATCTCGCTATTGACGGAGCAGACGAGGTAGATC
CGAATCTTGATTTAGTCAAAGGTCGTGGAGGTGCTCTTCTCCGTGAGAAAATGGTGGAAGCTGTGGCTGAGAAGTTTATC
GTTGTGGCTGATGATACCAAACTCGTTACAGGACTCGGTGGAAGTGGATTAGCTATGCCGGTGGAAGTTGTTCAATTCTG
CTGGAACTTTAATTTGATTAGATTGCAGGATCTGTTTAAGGAATTTGGATGTGATGCTAAGCTTAGAGTTGATGGAGATG
GCAAGCCTTATGTGACTGATAACAGTAATTACATTATTGATTTGTATTTTAAGAATCCTTTGAAGGATGGATTCGCGGCG
GCGAAAGAGATCGGCAAGTTTCAAGGAGTGGTGGAGCATGGTCTGTTTCTAGGAATGGCTACTTCTGTGATTATCGCTGG
AAAGAATGGTGTTCAAGTTATGACCAAGTGA