Details for Lyrate rockcress Locus 16042311

Position : sca3 ( 5`- 9145701 .. 9146887 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042311

Protein [Map View]
MEQELDLTLKLGLPNSTVDTHLSLNLSTTTTNQGDNNNDGGEVLNYRRALWGNDEVIHNEAARNNVEFNIRIYNYVFQQL
AGAPNTLNFAPYPMPSPAPAPAPAPAPETPPASDEYVLIDVPARRVRRNNSQTMANTWNENATAKRLRGCGGSCGGRIEG
MKKCTNMNCNALNTPMWRRGPLGPKSLCNACGIKFRKEEERKAKRNGVIELDN*

DNA
ATGGAGCAGGAATTGGACTTAACACTGAAGTTGGGTTTGCCAAATTCGACTGTTGACACACATCTGAGCTTAAACCTTTC
CACCACCACCACTAATCAGGGAGACAACAACAACGACGGCGGCGAAGTTTTGAACTACCGTCGGGCTCTTTGGGGAAATG
ATGAAGTGATCCACAACGAAGCTGCAAGAAACAACGTGGAATTCAACATCAGAATCTACAATTACGTTTTTCAACAGTTA
GCTGGCGCCCCCAACACCTTGAACTTTGCTCCTTATCCGATGCCATCTCCGGCACCGGCTCCGGCACCAGCACCGGCTCC
GGAGACTCCTCCGGCGAGTGATGAGTATGTTCTGATTGATGTTCCTGCTAGGAGAGTTCGTCGTAACAACTCTCAGACGA
TGGCAAACACTTGGAACGAAAACGCAACCGCGAAACGGCTTCGCGGTTGCGGTGGATCCTGCGGGGGAAGGATTGAAGGG
ATGAAGAAGTGTACGAACATGAATTGTAACGCACTTAACACTCCTATGTGGCGCAGGGGTCCTCTTGGTCCTAAGAGTTT
ATGCAATGCTTGTGGGATCAAGTTCAGGAAGGAGGAAGAGAGGAAAGCCAAAAGAAATGGAGTGATTGAATTAGATAACT
AA