Details for Lyrate rockcress Locus 16042308

Position : sca3 ( 5`- 10700877 .. 10702241 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042308

Protein [Map View]
MGTLWFGEIRKQASSFIQDKYNVARLVLTDVTEAELLVEEVTNDDPSSPDAKTVTKIAEASFDTVDYWRIVDEGEMKKWR
EAYKAMVLLEFLLTHGPLHLPHDFLYDLDHFRFLSTFQYVDDNGFDWGAQVQKKAEQIQTLLLGKEELREARLKALKITS
QINGFGNSTTFSPSPSPSNSFSPLKTSNSTPTKRNNPISESDSLIDCENKLTEKDRTGEETLISGICSKLAGFSPLKKFN
GGRTTAAKFQTLSNVERVSSKCYDRRNSIGY*

DNA
ATGGGGACACTTTGGTTTGGAGAAATCAGGAAACAAGCCTCTTCGTTTATTCAAGACAAGTACAATGTTGCTAGACTTGT
CCTCACCGATGTTACCGAAGCTGAGTTGTTAGTTGAAGAGGTGACAAATGATGATCCTTCTTCACCAGACGCTAAAACGG
TGACGAAAATAGCCGAGGCATCGTTTGATACTGTGGACTATTGGAGAATTGTGGATGAAGGGGAAATGAAGAAGTGGAGA
GAAGCGTACAAAGCAATGGTGTTGTTGGAGTTTTTACTAACACATGGTCCTCTTCATTTGCCTCATGATTTTCTTTATGA
CTTGGATCATTTTCGATTCCTCTCTACTTTCCAATACGTTGACGATAATGGGTTTGATTGGGGAGCTCAAGTTCAGAAAA
AGGCAGAGCAAATACAAACTCTTCTTTTAGGAAAAGAAGAATTAAGAGAAGCTCGTCTTAAAGCTCTCAAAATCACTTCC
CAAATCAATGGCTTTGGTAACTCCACCACATTCTCTCCTTCTCCTTCCCCATCTAACTCCTTCTCTCCCTTAAAAACCTC
CAATTCAACACCAACCAAAAGAAACAATCCTATATCCGAATCCGATTCATTAATCGACTGCGAAAACAAGCTCACGGAGA
AGGATCGAACCGGTGAAGAGACGCTAATCAGCGGAATCTGCTCCAAACTCGCCGGATTTAGTCCTTTGAAGAAATTTAAC
GGTGGTCGTACCACGGCGGCAAAATTTCAAACTTTGTCGAACGTTGAGAGAGTTTCAAGTAAATGTTACGATCGTCGCAA
TTCTATTGGCTACTAA