Details for Lyrate rockcress Locus 16042291

Position : sca3 ( 5`- 1018648 .. 1019352 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042291

Protein [Map View]
MGFKVLHQKRDGPKTGRIQNQPGQSITNVFFSMFLVLHYLTNQANSDSSLEHTGITTPLPPPPPRKTYCSRSSSSPPPPK
YMYVTGVPGELYRTEPDDQWGYYSSVNRNLVKCLMVIVIVGFGVINL*

DNA
ATGGGGTTTAAGGTTCTTCACCAGAAACGAGATGGGCCTAAAACAGGCCGGATTCAAAATCAACCAGGCCAGTCCATCAC
TAATGTGTTTTTCTCCATGTTCCTCGTGTTACACTATCTCACTAATCAAGCCAATTCCGATTCTTCCCTAGAACATACCG
GAATTACAACTCCGTTGCCGCCACCGCCACCAAGAAAGACTTACTGCAGTAGGTCATCTTCATCTCCACCTCCGCCTAAA
TACATGTATGTGACCGGTGTGCCTGGGGAACTCTACCGGACCGAGCCAGACGACCAATGGGGATATTATTCTAGTGTAAA
CCGGAATCTGGTTAAGTGTCTCATGGTTATTGTAATTGTGGGGTTTGGAGTTATAAATCTGTGA