Details for Lyrate rockcress Locus 16042263

Position : sca5 ( 5`- 17996288 .. 17995929 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042263

Protein [Map View]
MSLKATTVTKSMFVALFTIIAMAALASAATSLVQSPESDHLVNKCMAKLSSRCAMYVTAEVLYSHGPLKQHGCCLEVYHM
GRVCLNIVTKHVIQTFLPKLRKQDSLEKSTQIWYLCVPV*

DNA
ATGTCCCTCAAAGCAACTACCGTCACCAAATCCATGTTTGTAGCCTTATTCACAATTATCGCCATGGCTGCATTGGCATC
TGCAGCGACCAGTTTGGTTCAGTCTCCAGAATCAGACCACTTGGTTAACAAATGTATGGCTAAGTTATCTTCAAGGTGTG
CGATGTATGTCACTGCCGAAGTACTGTATAGCCATGGTCCGTTGAAACAACACGGATGTTGTCTAGAAGTTTATCACATG
GGACGTGTTTGTCTTAACATCGTGACCAAACATGTAATCCAGACGTTTTTGCCCAAGCTTCGAAAACAAGACTCTCTAGA
GAAAAGCACACAAATATGGTATCTTTGTGTTCCGGTTTAA