Details for Lyrate rockcress Locus 16042237

Position : sca3 ( 5`- 4664761 .. 4666440 -3` )
Annotation : [B2G] 2-cys chloroplast
External links : CoGe
PGDD synteny : 16042237

Protein [Map View]
MASLASSTTLISSPSSRVFPAKSSLSSPSVSFLPTLSSPSASASLRSGFAQRSSLSSTSRRSFAVKAQADDLPLVGNKAP
DFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEILGVSVDSVFSHLAWVQTDRK
SGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEV
CPAGWKPGEKSMKPDPKLSKEYFSAI*

DNA
ATGGCGTCTCTAGCTTCTTCAACTACTCTCATATCTTCTCCATCTTCTAGGGTTTTTCCAGCAAAGTCTTCACTTTCCTC
TCCATCTGTTTCTTTCCTTCCAACCCTTTCCTCTCCTTCCGCATCTGCTTCTCTCCGCTCCGGCTTCGCTCAACGCTCTT
CCCTCAGCTCCACTTCTCGCCGGAGCTTTGCTGTCAAAGCCCAGGCCGATGATCTTCCACTGGTTGGAAACAAGGCGCCT
GATTTCGAGGCAGAGGCTGTGTTTGATCAGGAGTTCATCAAGGTTAAGCTCTCTGAGTACATTGGAAAGAAGTATGTGAT
TCTCTTTTTCTACCCATTGGACTTCACTTTCGTCTGCCCAACAGAGATTACTGCCTTCAGTGACCGGCATTCAGAATTTG
AGAAGTTGAACACCGAAATATTAGGTGTTTCTGTCGATAGTGTGTTCTCTCACCTTGCATGGGTCCAAACAGACAGGAAA
TCGGGAGGGCTTGGTGATCTGAACTATCCCCTTATTTCAGATGTCACTAAATCAATCTCAAAATCTTTTGGAGTGCTCAT
CCATGATCAGGGAATAGCACTGAGAGGGCTCTTCATAATTGACAAGGAAGGAGTGATCCAACATTCCACCATCAACAATC
TTGGTATTGGCCGAAGCGTTGATGAGACAATGAGAACCCTCCAGGCATTACAGTACATCCAAGAAAACCCGGATGAGGTC
TGCCCAGCGGGATGGAAGCCGGGTGAGAAGTCAATGAAACCTGACCCGAAACTCAGCAAAGAGTACTTCTCAGCTATTTA
G