Details for Lyrate rockcress Locus 16042224

Position : sca3 ( 5`- 6976796 .. 6976644 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042224

Protein [Map View]
MVASWPLYAQQFNRVVIVNEIKLAIPMNESDMDFVSSMEVENQDNARWSG*

DNA
ATGGTTGCATCATGGCCTTTGTACGCTCAACAGTTTAATAGAGTAGTGATTGTGAATGAAATCAAGCTTGCAATTCCGAT
GAATGAATCAGACATGGATTTCGTGAGCTCAATGGAGGTGGAGAATCAAGATAATGCAAGATGGTCCGGTTAG