Details for Lyrate rockcress Locus 16042211

Position : sca3 ( 5`- 4384307 .. 4385947 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478433 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16042211

Protein [Map View]
MAIRCVASRKTLAGLKETSSRLLGFRGVQTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVNK
GDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPVQEGGGEPPKGSLGSAIDTHFGSPEGLVKKMSAEGAAVQGSGWVWLGL
DKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKECN*

DNA
ATGGCGATTCGTTGTGTAGCGAGTAGAAAAACCCTAGCCGGCTTGAAGGAGACATCATCGAGGCTCTTAGGATTCAGAGG
GGTTCAGACTTTTACGCTTCCTGATCTTCCTTACGATTATGGCGCATTGGAACCGGCGATTAGTGGAGAGATCATGCAGA
TTCATCACCAGAAGCATCACCAGGCTTATGTTACTAATTACAATAATGCTCTTGAGCAGCTGGATCAGGCTGTGAATAAA
GGAGATGCTTCCACTGTTGTTAAGTTGCAGAGCGCTATCAAATTCAACGGCGGAGGTCATGTCAACCATTCGATTTTCTG
GAAGAACCTTGCTCCTGTCCAGGAAGGTGGTGGAGAGCCACCAAAAGGATCTCTTGGCAGCGCCATTGATACTCACTTTG
GCTCTCCTGAAGGTCTGGTGAAAAAGATGAGTGCTGAAGGTGCTGCTGTGCAAGGCTCCGGATGGGTGTGGCTCGGACTA
GACAAAGAACTGAAGAAGCTTGTGGTTGACACAACTGCCAATCAGGATCCATTGGTGACAAAAGGAGGAAGCTTGGTACC
TCTGGTGGGTATAGATGTTTGGGAGCACGCCTACTACTTGCAGTACAAAAATGTGAGGCCGGAGTATCTGAAGAATGTAT
GGAAAGTGATCAACTGGAAATATGCAAGCGAGGTTTATGAGAAGGAATGCAACTGA