Details for Lyrate rockcress Locus 16042175

Position : sca3 ( 5`- 22184053 .. 22185441 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16042175

Protein [Map View]
MGKVPSSFRAMPANLLVKKPTPSPPAPPRDFRNRAAVRDSTKLPENTQAPREPSLRNPFKSPNLSDAKSLFNSIAATSRI
PLDLKFHNSVLQSYASIAAVDDTVKLFQHILKSQPNFRPGRSTFLILLSHACRAPDSSISNVHRVLNLMVNNGLEPDQVT
TDIAVRSLCETGRVDEAKDLMKELTEKHSPPDTYTYNFLLKHLCKCKDLHVVYEFVDEMRDDFDVKPDLVSFTILIDNVC
NSKNLREAMYLVSKLGNAGFKPDCFLYNTIMKGFCTLSKGSEAIGVYKKMKEEGVEPDQITYNTLIYGLSKSGRVEEARM
YLKTMVDAGYEPDTATYTSLMNGMCRKGESLGALSLLEEMEARGCAPNDCTYNTLLHGLCKARLMDKGMELYELMKSSGV
KLETNGYATLVRSLVKSGKVAEAYEVFDYAVDSKSLTDASAYSTLETTLKWLKKAKEQGLVA*

DNA
ATGGGGAAAGTTCCGTCGTCGTTTCGTGCTATGCCGGCGAACTTATTGGTCAAAAAACCAACACCATCTCCTCCAGCGCC
GCCGCGTGATTTTCGCAACAGAGCAGCCGTGAGAGATTCAACTAAACTTCCAGAGAATACTCAAGCCCCTCGCGAGCCCT
CCTTGAGGAATCCTTTCAAGTCACCAAATCTCTCAGACGCCAAAAGCCTCTTCAATTCAATCGCCGCCACTTCAAGAATC
CCACTCGATCTCAAATTCCACAACTCTGTTCTTCAATCCTACGCTTCAATCGCCGCCGTCGACGATACGGTGAAGTTGTT
TCAGCATATTTTGAAATCTCAACCTAATTTCAGGCCGGGACGTTCTACGTTCCTTATCTTGCTTTCACATGCTTGTAGAG
CTCCTGATTCATCGATTTCGAATGTTCATAGAGTTCTTAACCTTATGGTGAATAATGGTTTAGAGCCTGATCAAGTAACA
ACCGATATCGCGGTTCGGTCTCTTTGCGAAACCGGTCGGGTTGATGAAGCTAAGGATTTGATGAAGGAGCTGACGGAGAA
ACATTCCCCTCCGGATACATATACTTATAACTTTCTACTGAAGCATTTGTGCAAATGCAAAGATCTACATGTTGTTTATG
AGTTTGTTGATGAGATGAGGGACGATTTCGATGTGAAGCCGGACCTTGTTAGCTTCACTATCTTGATTGATAATGTGTGT
AACTCTAAGAACTTGAGGGAGGCAATGTATCTAGTTAGTAAATTAGGTAATGCTGGGTTCAAGCCGGATTGTTTCCTCTA
TAACACCATTATGAAAGGTTTTTGCACACTGAGTAAAGGGAGCGAGGCGATTGGTGTTTATAAGAAAATGAAGGAAGAAG
GTGTTGAGCCAGATCAGATTACTTACAATACTTTGATATATGGATTGTCGAAATCTGGTAGAGTTGAGGAAGCTAGGATG
TACTTGAAAACTATGGTTGATGCGGGGTATGAGCCGGATACTGCCACTTACACGTCGCTGATGAATGGAATGTGTAGAAA
AGGCGAGTCTTTAGGTGCGTTGAGTTTGTTAGAAGAAATGGAAGCAAGAGGGTGTGCTCCAAATGATTGCACCTATAATA
CTTTGCTTCATGGATTGTGCAAGGCAAGGTTGATGGATAAAGGGATGGAGTTATATGAATTGATGAAATCAAGCGGTGTA
AAGCTTGAGACCAATGGTTATGCCACTCTTGTGAGGTCTCTGGTTAAAAGTGGCAAGGTCGCAGAGGCTTATGAAGTCTT
TGATTATGCAGTTGATAGCAAGAGTTTGACAGATGCTTCTGCGTACTCTACACTTGAAACTACCTTGAAATGGTTGAAAA
AAGCTAAAGAACAAGGCTTGGTTGCCTAA