Details for Lyrate rockcress Locus 16041980

Position : sca3 ( 5`- 4020653 .. 4017808 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041980

Protein [Map View]
MDQPRQSSTASQPPETPPQPSDSASKPATLTQIQPPPSTNPSPSSVVSSIPSSPAPQSPSLNPNPNPPQYARPVTSPVTQ
QQQHLSQPLVRPPPQAYSRPWQQHSSYTHFSSASSPLLSSSSAPASSSSSLPITGQQRGGMAIGVPASPIPSPSPTPSQH
TPSAFPGSFGQQYGGLGRGTVGMSEATSNSSAPQVRMMQGTQGIGMMGTLGSGSQMRPSGMAQHQQRPTQSSLRPASSPS
TQSPVAQNFQGHSLMRPSPIGSPSVQSTGASQQSLQAINQPWLSSTPQGKPPLPPPSYRPQVNSPSMQQRPHIPQQHLST
SAATSQPQQLQSQQQHQPQEQLQQLRSPQQPLPHPHQPTRVQGLVNQKVTSPVMPSQPPVAQPGNHAKTVSAENETSDDR
ILGKRSIHELLQQIDPSEKLDPEVEDILADIAEDFVESITTFGCSLAKHRKSDTLEAKDILLHVERNWNIRPPGFSSDEF
KTFRKPLTTDIHKERLAAIKKSVTATEAASARNQFGHGTANARGGQSKTPSNPLGSTTFNH*

DNA
ATGGATCAGCCACGGCAAAGCTCGACGGCGTCTCAGCCACCGGAAACACCTCCTCAGCCATCAGATTCAGCTTCGAAACC
AGCGACTTTAACACAGATTCAACCACCGCCTTCTACAAATCCGAGTCCCTCCTCCGTTGTTTCCTCTATTCCTTCTTCCC
CAGCTCCACAATCACCATCGCTCAATCCAAACCCTAATCCTCCTCAATACGCGCGTCCGGTGACATCTCCGGTGACGCAA
CAGCAGCAACATCTCTCCCAGCCTTTGGTACGGCCGCCTCCGCAGGCGTACTCGAGACCATGGCAACAACACTCCTCTTA
CACTCACTTCTCCTCCGCTTCGTCGCCATTGTTATCTTCCTCATCAGCTCCGGCTTCTTCGTCTTCGTCTTTACCTATTA
CTGGGCAACAAAGAGGTGGCATGGCGATTGGCGTTCCAGCTTCCCCAATTCCGAGTCCTTCTCCTACACCTTCTCAACAT
ACGCCTTCTGCTTTTCCCGGCTCTTTTGGGCAGCAGTACGGCGGATTAGGTCGTGGAACTGTCGGAATGTCAGAAGCTAC
GTCCAATTCAAGTGCCCCTCAGGTTAGAATGATGCAAGGAACTCAGGGAATTGGGATGATGGGGACACTTGGCTCAGGTT
CCCAAATGAGGCCGAGTGGGATGGCTCAGCACCAACAGAGACCAACTCAATCGTCTCTAAGACCAGCTTCCTCCCCAAGT
ACCCAATCTCCTGTTGCCCAAAACTTTCAAGGACATAGCCTTATGAGACCTTCACCTATTGGCTCTCCTAGTGTCCAATC
TACTGGTGCATCACAACAAAGCTTGCAAGCCATTAATCAACCTTGGTTATCATCTACTCCCCAAGGGAAGCCGCCTTTGC
CACCTCCTTCGTATAGACCACAAGTAAATTCTCCCTCCATGCAACAAAGACCTCATATTCCTCAGCAACATCTTTCTACG
TCAGCAGCAACTTCACAGCCTCAGCAACTACAATCTCAACAACAACATCAGCCTCAAGAGCAACTTCAACAATTGAGATC
TCCGCAGCAGCCTTTACCTCACCCACATCAACCAACCCGGGTCCAAGGGTTGGTAAATCAGAAAGTTACTTCTCCGGTAA
TGCCAAGCCAGCCTCCTGTGGCTCAACCAGGAAACCATGCTAAAACAGTTTCTGCAGAGAATGAGACATCTGATGATCGT
ATCCTGGGGAAACGAAGCATCCATGAGCTACTTCAACAGATTGACCCGTCAGAGAAATTGGATCCAGAGGTTGAAGACAT
CCTTGCTGATATTGCTGAAGATTTTGTGGAATCAATCACAACTTTTGGCTGTTCTTTAGCCAAGCATAGAAAGTCAGATA
CTCTAGAGGCTAAGGACATCTTGCTCCATGTTGAAAGAAACTGGAATATCAGGCCTCCTGGTTTTAGCAGTGATGAGTTC
AAGACATTTCGAAAGCCATTGACAACAGATATTCACAAAGAGCGACTTGCGGCAATAAAGAAGTCGGTCACGGCAACAGA
AGCAGCAAGCGCCAGGAATCAGTTTGGGCATGGGACTGCTAATGCAAGAGGCGGTCAGTCAAAGACGCCTTCTAATCCCT
TGGGCTCTACAACTTTCAATCACTGA