Details for Lyrate rockcress Locus 16041954

Position : sca3 ( 5`- 6350814 .. 6351918 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041954

Protein [Map View]
MATIVQCLSSCATLESQFKVLSLKGISSSSSFSNRRGGASATLSSSLSFSQSVSQCVAFSSGNLWVQKPTRQLIVCEAAA
PTKKADSAAKRARQAEKRRIYNKSKKSEARTRMKKVLEALEGLKKKTDAQPDEIVTVEKLIGEAYSAIDKAVKVKALHKN
TGARRKSRLARRKKAVEIHHGWYVPDAVASEAVTMAA*

DNA
ATGGCGACGATAGTGCAGTGTCTTTCTTCCTGTGCGACCCTCGAATCCCAATTCAAAGTCCTTTCTCTTAAGGGAATCTC
ATCATCTTCTTCCTTCTCCAATCGTCGTGGTGGTGCTTCGGCTACTTTATCCTCTTCCCTTAGCTTCTCTCAGAGCGTTT
CTCAATGCGTCGCCTTCTCCTCCGGGAATTTGTGGGTACAGAAGCCAACGAGGCAATTGATTGTTTGTGAGGCTGCTGCA
CCAACGAAGAAAGCTGATTCAGCTGCAAAGAGAGCTCGCCAAGCCGAGAAGAGGCGTATTTATAACAAATCTAAGAAATC
TGAAGCCCGTACACGGATGAAGAAGGTCTTGGAAGCACTTGAGGGGCTCAAGAAGAAAACTGATGCGCAGCCTGATGAGA
TTGTGACTGTGGAGAAACTAATAGGAGAGGCATATTCTGCAATAGACAAAGCAGTAAAGGTTAAAGCGCTACACAAGAAC
ACTGGTGCACGTAGAAAGTCTCGGTTGGCTAGGAGGAAAAAAGCCGTTGAGATTCACCACGGTTGGTACGTCCCAGATGC
AGTAGCATCAGAAGCTGTGACCATGGCTGCATAA