Details for Lyrate rockcress Locus 16041940

Position : sca5 ( 5`- 17970494 .. 17969410 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_486095 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16041940

Protein [Map View]
MAIPQRNKRKARSSPEPPHNSDIPSSAADNFFSPSTNPFVFPPGYRFVPNDEELILHYLKPFSQGNKCSFLNVPINHVNI
YESNPQQLSEKYEKGNDKEWFFISERTKIGEAGRNKKRVANGGYWNATVATKRIDAGNGIVGYKISLEYYVGKQPNGVKG
DWLMHEYWFESSDDNNNEKVDHVLCKIYLTPTAAKKKKAEEEENEKLKKEEVVFKEEVKQLDLHQSDQSHPHDIVYQPQS
FPYDLDHFSELISFEQQPVIPEDFEDFLADFIKPHPLDGDEESNNYGLFEGFFDTQGMIKH*

DNA
ATGGCGATTCCACAAAGAAACAAGCGCAAAGCACGATCCTCGCCGGAACCACCACACAACTCCGACATTCCTTCTTCTGC
CGCTGATAACTTCTTTTCTCCGTCGACGAACCCGTTCGTTTTCCCGCCAGGTTATAGATTTGTACCAAATGACGAAGAAC
TCATCTTGCATTACTTGAAACCCTTCTCGCAAGGCAACAAATGCTCATTTCTCAATGTTCCTATCAATCACGTGAACATC
TACGAGTCAAATCCACAACAGCTTTCAGAGAAATATGAGAAGGGTAATGATAAAGAATGGTTCTTTATATCGGAGAGGAC
CAAGATCGGTGAAGCTGGAAGAAATAAGAAACGTGTCGCCAATGGAGGATATTGGAACGCAACTGTAGCTACCAAGAGGA
TTGACGCTGGAAATGGCATAGTCGGCTACAAAATCTCACTAGAATACTACGTTGGGAAACAACCCAATGGTGTAAAAGGG
GATTGGTTAATGCATGAATACTGGTTTGAGTCTTCAGATGATAACAACAACGAGAAGGTAGATCATGTTTTGTGCAAGAT
TTATCTGACTCCAACGGCAGCAAAGAAGAAGAAAGCAGAGGAAGAAGAGAATGAGAAGCTGAAGAAAGAAGAAGTCGTAT
TCAAAGAAGAGGTTAAGCAGCTGGATTTGCATCAATCGGACCAATCGCATCCTCATGATATTGTGTATCAGCCGCAGTCT
TTTCCTTATGACTTGGATCATTTTTCTGAGTTGATCAGCTTTGAACAGCAACCAGTGATCCCAGAAGATTTTGAAGATTT
CTTGGCTGATTTCATTAAGCCACATCCACTAGATGGAGATGAAGAATCCAACAATTATGGTTTATTTGAAGGCTTCTTCG
ACACACAAGGAATGATAAAACATTAA