Details for Lyrate rockcress Locus 16041915

Position : sca3 ( 5`- 8298905 .. 8297126 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_318682 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16041915

Protein [Map View]
MEVWHFQIAVYFAFGFFFLRLFLDRFVFQRIAVWLLSTGSSPMKLNDATTRAKIVKCKESLWKLLYYAACDFCVLQVVYH
EPWARDIKLYFDGWPNQELKLSIKLYYMCQCGFYMYGVAALLAWETRRKDFAVMMSHHVITIILLSYSYLTSFFRIGAII
LALHDASDVFMETAKIFKYSEKEFGASVCFALFALSWLLLRLIYFPFWIIWATSIELLDYLDMTSAEGTIMYYSFNTMLL
MLLVFHIYWWYLICAMIVRLLKNRGKVGEDIRSDSEDDD*

DNA
ATGGAGGTGTGGCATTTCCAGATTGCTGTCTATTTCGCTTTCGGATTCTTCTTCTTGAGGCTTTTCCTCGATAGATTCGT
CTTTCAAAGGATAGCTGTTTGGCTTTTGAGTACCGGTTCTTCTCCGATGAAATTGAATGATGCTACTACTCGGGCAAAAA
TCGTCAAATGCAAGGAGTCTTTGTGGAAATTGTTGTATTATGCTGCTTGTGACTTTTGCGTTCTTCAAGTCGTTTATCAC
GAGCCGTGGGCCAGAGATATCAAACTCTACTTCGACGGTTGGCCAAATCAAGAGTTGAAGCTTTCAATAAAGCTTTACTA
TATGTGCCAGTGCGGTTTTTATATGTATGGTGTGGCTGCGTTGCTTGCATGGGAGACAAGAAGAAAGGATTTTGCTGTCA
TGATGTCTCACCATGTAATTACAATCATCCTGCTTAGCTACTCCTACTTAACCAGTTTTTTCCGGATTGGAGCAATCATC
CTAGCCCTTCATGATGCAAGTGACGTGTTTATGGAAACGGCTAAAATTTTCAAGTACTCTGAAAAAGAATTTGGGGCAAG
TGTGTGTTTTGCACTATTTGCTCTCTCCTGGCTATTGCTACGGTTGATATACTTCCCATTTTGGATCATCTGGGCCACGA
GCATTGAACTCCTGGATTATTTGGATATGACATCAGCTGAAGGCACGATCATGTACTATTCTTTCAACACAATGTTACTG
ATGCTTCTCGTTTTCCACATATATTGGTGGTATCTCATCTGTGCCATGATTGTAAGACTACTTAAAAACAGAGGAAAAGT
TGGAGAAGACATAAGATCCGATTCAGAGGATGATGATTAG