Details for Lyrate rockcress Locus 16041901

Position : sca3 ( 5`- 9545791 .. 9544148 -3` )
Annotation : [B2G] endonuclease exonuclease phosphatase family protein
External links : CoGe
PGDD synteny : 16041901

Protein [Map View]
MLCVFRRKLGCFFSRIRWVIKKRVRARVIVRRFRKARWRARRKESPESEVSSIHLSSNSRRHIRVATFNVAMFSLAPVVQ
NIEETTFLGHIDSNNITCPSPKGILKQSPLHSSAVRKPKVCINLPDNEISLAQSYSFLSMVENDSDGKENRGSISMRSPV
CLPSCWWDQESFNGYSSRRSIAELLRELDADILALQDVKAEEETLMKPLSDLASALGMKYVFAESWAPEYGNAILSKWPI
KKWRVQRIADVDDFRNVLKVTVEVPWAGDVNVYCTQLDHLDENWRMKQIDAITRGDESPHILLGGLNSLDGSDYSIARWN
HILKVKYYEDSGKPTPRVEVMRFLKGKGYLDSKEFAGECEPVVIIAKGQNVQGTCKYGTRVDYILASPESPYEFVPGSYS
VVSSKGTSDHHIVKVDLVITKERSRGSFKHSRKKAKQKIFQIKANLMSGDTWKLGNLMSS*

DNA
ATGTTGTGTGTGTTTAGAAGGAAGCTTGGTTGCTTTTTTTCAAGAATTCGATGGGTGATCAAGAAACGGGTGAGAGCCAG
AGTTATAGTCAGGAGGTTCAGGAAAGCAAGGTGGAGAGCTAGAAGAAAAGAGAGTCCGGAATCCGAAGTTTCTTCTATCC
ATCTGAGCTCAAACTCTAGAAGACATATTCGGGTTGCAACGTTTAACGTGGCGATGTTCTCACTTGCGCCTGTTGTGCAA
AACATTGAGGAAACAACTTTTCTTGGTCATATAGATAGCAACAACATCACATGCCCTTCTCCAAAAGGGATTCTGAAGCA
GTCTCCTTTACATTCTTCTGCAGTCAGGAAACCAAAGGTCTGTATTAATCTTCCAGACAATGAGATTTCCTTAGCACAGA
GCTACAGCTTTCTGAGTATGGTAGAGAATGATAGCGACGGGAAGGAAAACAGAGGAAGTATCTCTATGAGATCTCCCGTG
TGCCTTCCCTCTTGTTGGTGGGACCAAGAAAGCTTTAACGGATACAGCAGCAGAAGAAGCATAGCTGAGTTGTTAAGAGA
GTTGGATGCAGACATCTTGGCTTTGCAAGACGTGAAAGCAGAGGAAGAGACTCTTATGAAGCCATTATCAGATTTGGCTT
CTGCCTTAGGTATGAAATATGTTTTTGCAGAGAGCTGGGCGCCGGAGTATGGCAACGCCATTCTGTCAAAATGGCCCATA
AAGAAGTGGAGAGTTCAGAGAATTGCTGATGTAGATGACTTTAGGAATGTGTTGAAGGTGACTGTAGAGGTCCCATGGGC
TGGAGATGTAAATGTGTATTGTACTCAACTTGACCATCTAGATGAGAACTGGCGGATGAAGCAAATCGATGCAATTACTC
GAGGAGATGAATCTCCTCACATCTTGCTGGGAGGCTTGAATTCTCTTGATGGCTCTGATTATTCCATAGCAAGATGGAAC
CACATATTAAAGGTAAAGTATTACGAGGATTCGGGAAAGCCGACGCCTAGAGTTGAAGTGATGAGATTTCTCAAGGGTAA
AGGATACTTGGATTCAAAAGAATTTGCAGGAGAATGTGAGCCTGTTGTCATTATTGCCAAAGGACAAAATGTACAAGGAA
CATGCAAGTACGGGACACGGGTCGATTACATTCTGGCATCTCCAGAGTCACCTTACGAATTCGTTCCTGGCTCATATTCA
GTTGTTTCTTCCAAAGGTACTTCTGATCATCATATAGTCAAAGTCGATTTAGTTATAACCAAAGAGCGATCTCGAGGTAG
CTTCAAACATTCGCGCAAGAAGGCAAAGCAGAAGATCTTTCAGATTAAAGCTAATTTGATGTCAGGAGATACATGGAAAC
TAGGAAATCTTATGTCTTCATAA