Details for Lyrate rockcress Locus 16041876

Position : sca3 ( 5`- 9543318 .. 9543938 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041876

Protein [Map View]
MSETSSLLLPKTNSPASSETMANKSLTGLESLIKLLPTGTLFIYLLLNPVLTNDGECSTGNKVMSSILVALCSFSCVFSC
FTDSFKGVDGSRKFGIVTKKGLWTYAEPGSVDLSKYKLRIADFVHAGFVLAVFGALVLLDANTASCFYPRFRETQKTLVM
ALPPAVGVASAAIFALFPSKRSGIGYAPIAEEVAVEEEAKKGSVSA*

DNA
ATGTCCGAAACTTCTTCTTTGCTATTACCCAAAACAAACTCTCCAGCTTCATCAGAAACCATGGCAAACAAATCCCTCAC
AGGCCTAGAGAGTCTTATAAAGCTTCTCCCAACGGGAACACTCTTTATCTACCTTTTACTTAACCCTGTCCTCACTAACG
ACGGTGAATGCTCCACGGGTAATAAGGTCATGTCGAGCATTCTTGTCGCGCTTTGCAGCTTCTCCTGCGTGTTTTCATGC
TTTACGGATAGTTTCAAAGGTGTCGACGGATCAAGAAAGTTCGGTATTGTCACCAAGAAGGGTCTTTGGACTTACGCGGA
GCCAGGATCCGTGGATTTGTCCAAGTACAAGCTCAGGATCGCGGATTTCGTTCATGCGGGTTTCGTGCTAGCTGTGTTTG
GTGCACTGGTGTTGCTTGACGCTAATACCGCGAGCTGCTTTTATCCTCGGTTCAGGGAAACGCAAAAGACACTTGTCATG
GCTTTGCCTCCAGCCGTGGGTGTTGCCTCAGCTGCTATCTTTGCTTTGTTTCCGAGCAAACGGAGTGGAATCGGGTACGC
ACCAATCGCTGAGGAGGTAGCTGTTGAAGAGGAGGCCAAGAAAGGCTCTGTCTCTGCCTAA