Details for Lyrate rockcress Locus 16041872

Position : sca3 ( 5`- 7245782 .. 7241886 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479163 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16041872

Protein [Map View]
MALSFSQTSFTRPNHVLGSTGSVFSTPTSLRFCGLRREAFGFSPSNQLALNSDRIQFPSRKSFQVSASASSNGNGAPPKS
FDYDLIIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPSKALLAVSGRMRELQNEHHMKSFGLQVSAAGYD
RQGVADHANNLATKIRNNLTNSMKALGVDILTGFGSVLGPQKVKYGKDNIITAKDIIIATGSVPFVPKGIEVDGKTVITS
DHALKLESVPEWIAIVGSGYIGLEFSDVYTALGSEVTFIEALDQLMPGFDPEISKLAQRVLINPRKIDYHTGVFATKITP
AKDGKPVLIELIDAKTKEPKDTLEVDAALIATGRAPFTNGLGLENVNVVTQRGFIPVDERMRVIDGNGTLVPNLYCIGDA
NGKLMLAHAASAQGISVVEQVTGRDHVLNHLSIPAACFTHPEISMVGLTEPQAKEKGEKEGFKVSVVKTSFKANTKALAE
NEGEGIAKMIYRPDNGEILGVHIFGLHAADLIHEASNAIALGTRIQDIKLAVHAHPTLSEVLDELFKAAKVESHATTRTG
DAKIKLNTNQEDQRGGDDGKQPSVSEDLKDISTKPSSFFENIYVGVLSLLSRIFV*

DNA
ATGGCGCTTTCGTTTTCCCAGACGTCGTTTACAAGACCAAACCACGTACTTGGATCAACTGGTTCCGTTTTTTCTACGCC
TACAAGTCTCCGGTTCTGCGGACTCCGGCGGGAAGCGTTTGGTTTCTCTCCATCGAATCAGTTGGCTTTGAACAGTGACC
GAATTCAATTTCCAAGTAGGAAATCATTCCAAGTCTCTGCTTCTGCTTCGAGTAATGGTAACGGCGCTCCGCCTAAATCT
TTCGATTACGATTTGATCATCATCGGAGCTGGAGTTGGTGGCCACGGAGCTGCTTTGCACGCTGTTGAAAAGGGACTTAA
AACTGCCATTATAGAAGGAGATGTTGTTGGAGGGACTTGTGTTAACAGAGGATGTGTACCTTCTAAAGCTCTTCTTGCTG
TTAGTGGTCGCATGCGGGAACTTCAGAACGAACATCACATGAAGTCTTTTGGTCTCCAGGTTTCAGCTGCTGGGTATGAT
CGTCAGGGTGTGGCAGACCATGCTAATAATCTGGCTACCAAAATACGAAACAATCTGACCAATTCAATGAAGGCACTTGG
TGTTGACATATTGACTGGATTTGGCAGTGTTCTGGGTCCACAAAAGGTTAAATATGGGAAGGACAATATTATCACTGCAA
AAGATATAATCATTGCCACTGGATCTGTGCCGTTTGTCCCTAAAGGAATTGAAGTTGATGGAAAGACTGTAATCACCAGT
GACCATGCTTTGAAATTGGAGTCTGTCCCTGAGTGGATTGCAATTGTAGGAAGTGGATATATTGGTCTTGAGTTCAGTGA
TGTTTACACGGCACTTGGAAGTGAGGTAACTTTTATTGAAGCACTGGATCAGCTAATGCCTGGATTTGATCCTGAGATCA
GTAAGCTAGCTCAGAGGGTTTTGATAAATCCAAGAAAGATTGACTATCATACTGGAGTCTTTGCAACCAAAATTACTCCA
GCAAAGGATGGGAAACCAGTTTTGATTGAGCTTATTGATGCCAAAACCAAGGAACCTAAGGATACCTTGGAGGTAGATGC
TGCTCTTATTGCTACTGGAAGAGCTCCATTCACCAATGGACTTGGCTTGGAAAATGTCAATGTTGTGACGCAGAGAGGTT
TCATACCAGTTGATGAGCGAATGCGTGTGATCGATGGAAATGGGACTCTGGTTCCGAACTTGTACTGCATTGGTGATGCC
AATGGTAAATTGATGCTTGCACATGCAGCCAGTGCCCAAGGAATTTCTGTGGTCGAGCAAGTCACCGGTAGAGATCATGT
GCTTAATCATCTTAGCATACCAGCTGCTTGCTTCACTCATCCTGAAATCAGCATGGTGGGATTGACAGAGCCTCAAGCGA
AAGAAAAAGGCGAGAAGGAAGGATTTAAAGTTAGTGTTGTCAAGACAAGTTTCAAGGCTAACACAAAGGCCCTAGCTGAA
AATGAAGGAGAAGGAATAGCAAAGATGATATACCGACCTGACAACGGTGAAATCCTAGGAGTTCATATATTTGGACTGCA
TGCAGCTGACCTTATCCATGAAGCTTCTAATGCGATTGCTCTAGGAACACGCATTCAGGACATAAAATTGGCAGTTCATG
CACATCCAACACTGTCTGAGGTTCTCGACGAACTGTTCAAAGCAGCCAAGGTTGAAAGTCATGCTACGACAAGGACAGGA
GATGCAAAGATAAAGCTAAACACGAACCAGGAAGATCAGAGAGGAGGAGATGATGGGAAGCAACCTTCAGTAAGTGAAGA
CTTGAAAGATATATCTACAAAGCCTTCTTCTTTCTTTGAGAATATTTACGTTGGAGTCTTGTCTCTGCTTTCACGTATAT
TTGTTTAA