Details for Lyrate rockcress Locus 16041851

Position : sca3 ( 5`- 10525680 .. 10526294 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479823 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16041851

Protein [Map View]
MERSNNIELRNSFYGRARTSPWSYGDYDNYQQDHEYLLGFSWPPRSYTCSFCKREFRSAQALGGHMNVHRRDRARLRLQQ
SSSSSSTPSPPYPNPNYSYSSMATSPPPHHSPLTLFPTLSPPSSPRYRPGLVRSLSPKSKHTPENACETEKSSLLVEAGE
AKRFTSKDACKILRNDDIISLELEIGLIKESEQDLDLELRLGFA*

DNA
ATGGAGAGATCAAACAACATAGAGTTGAGGAACAGCTTCTATGGCCGTGCAAGAACTTCACCATGGAGCTATGGAGATTA
TGATAATTACCAACAGGATCATGAGTATCTTCTAGGGTTTTCATGGCCACCCAGATCCTACACTTGCAGCTTCTGCAAAA
GGGAATTCAGATCGGCTCAAGCACTTGGTGGTCACATGAATGTTCACAGAAGAGACAGAGCCAGACTCAGATTACAACAG
TCTTCATCATCATCCTCAACACCTTCTCCTCCTTACCCTAACCCTAATTACTCTTACTCTTCCATGGCAACCTCTCCTCC
TCCTCACCATTCTCCTCTAACCCTATTTCCAACCCTTTCTCCTCCGTCATCACCAAGATATAGGCCAGGTTTGGTCCGTT
CCTTGAGCCCCAAGTCAAAACATACACCAGAAAACGCTTGTGAAACTGAAAAATCTTCTCTTTTAGTGGAGGCTGGAGAG
GCTAAAAGGTTCACCAGTAAAGATGCTTGCAAGATCTTGAGGAATGATGATATCATTAGCTTGGAGCTTGAGATTGGTTT
GATCAAAGAATCGGAGCAAGATCTGGATCTAGAACTCCGTTTGGGTTTCGCTTAA