Details for Lyrate rockcress Locus 16041833

Position : sca3 ( 5`- 11958342 .. 11958944 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041833

Protein [Map View]
MTLTLIHGGLSMSLQTGLCIFMTVASLSREIHWFAKDQLLEESTFLICFDFTSERFGPHLSMPYELYFEGTASLSSVKEE
QLAVLFQRWDTLEIEIWITTKIEPNAVSWNSKVFLAVNMRSFTCFDFQILLTHASFFIDKEKKVAVVFDKNKERNVNPTR
TVAYIVGVDGSLKEADLGEYGDKHCYPLVCSYVPSLVQLN*

DNA
ATGACTTTAACTCTGATTCATGGAGGGTTATCGATGTCACTCCAGACTGGACTATGTATTTTTATGACCGTGGCGTCTCT
CTCAAGGGAAATACATTGGTTTGCTAAAGACCAGCTTTTAGAAGAAAGTACTTTCTTAATCTGTTTTGATTTTACAAGCG
AGAGATTTGGACCGCATTTGTCTATGCCGTATGAGTTGTATTTTGAAGGTACTGCGAGTCTATCTAGTGTCAAAGAAGAG
CAGCTTGCAGTTTTGTTTCAACGTTGGGATACATTAGAGATAGAAATATGGATTACGACTAAGATTGAGCCCAACGCGGT
GTCTTGGAACAGCAAGGTGTTCTTAGCCGTGAATATGAGATCATTCACTTGCTTTGACTTTCAGATTTTGCTCACACATG
CGAGTTTCTTCATTGACAAGGAGAAGAAAGTCGCCGTAGTGTTTGATAAAAACAAAGAACGCAACGTAAACCCCACTCGC
ACCGTAGCTTACATCGTTGGAGTGGATGGATCCTTGAAAGAAGCCGATCTTGGAGAATATGGAGACAAACATTGTTATCC
ACTTGTGTGCTCTTATGTTCCAAGTTTAGTTCAACTTAATTAG