Details for Lyrate rockcress Locus 16041789

Position : sca3 ( 5`- 942305 .. 942697 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477563 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16041789

Protein [Map View]
MALEWVVLGYAAAAEAIMVVLLTMPGLDGLRKGLVAVTRNLLKPFLSIVPFCLFLLMDIYWKYETMPSCDGDSCTPSEHL
RHQKSMMKSQRNALLIAAALVFYWILYSVTNLVVRIEHLNQRIERLKNKD*

DNA
ATGGCTCTCGAATGGGTGGTTTTAGGTTACGCGGCGGCGGCCGAAGCGATTATGGTGGTGCTATTGACGATGCCGGGACT
TGACGGACTCCGCAAGGGATTAGTCGCCGTCACGCGTAATCTCCTCAAACCGTTTCTCTCGATTGTTCCTTTCTGTCTGT
TCCTCTTAATGGACATCTACTGGAAATACGAAACTATGCCTTCGTGCGACGGCGATTCCTGCACACCGTCGGAGCATCTT
CGTCACCAGAAATCAATGATGAAATCCCAGCGAAACGCGCTTCTGATTGCGGCTGCACTTGTGTTCTACTGGATCCTTTA
CTCAGTTACCAATTTGGTTGTCAGGATCGAGCATCTTAACCAGAGGATCGAGAGGCTCAAGAACAAGGATTGA