Details for Lyrate rockcress Locus 16041743

Position : sca3 ( 5`- 1614812 .. 1612453 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041743

Protein [Map View]
MAYGGPMNPPALSGPVSGSANLKQVKLERESELRIEVSEEPLRLRVVNGTAEIFGSELPPEIWRTFPARMKFAVFTWYGA
TIEMDGVTETDYTADETPMVSYINVHAILDARRRFAKASTSNDPESSQGPRVIVVGPTDSGKSTLTKMLLSWAAKQGWRP
TFVDLDVGQGSITIPGCIAAAPIEMPLDPVEGFPLDMALVYYYGHASPNINVELYKALVKELAQVLERQFVGNPESRAAG
MVINTMGWIEGIGYELLLHAIDTFNASVVLVLGQEKLFSRLKDVLRSKSNVDVVKLHKSGGVVARVKEVRKRSRNFKIQE
YFYGLSKELSPYANTSSFSDLQVFRIGGGPQAPKSALPAGSTSVSNPLRVTPVNIDDRDLLHSVLAVSYAEEPDQIISSN
VSGFVYVTEVNVQKKKITYLAPSPGTLPSKLLVAGSLTWLESV*

DNA
ATGGCTTACGGTGGTCCAATGAATCCACCGGCTTTAAGTGGCCCAGTTTCCGGGTCTGCTAATCTGAAGCAAGTGAAATT
GGAGAGAGAAAGCGAGCTCAGGATCGAAGTCTCTGAAGAGCCTCTCAGACTCCGTGTGGTGAACGGGACGGCTGAGATTT
TTGGCTCTGAACTGCCTCCTGAAATATGGCGTACGTTCCCTGCTCGCATGAAATTTGCGGTTTTCACTTGGTATGGAGCG
ACAATTGAGATGGATGGTGTCACGGAAACTGACTATACGGCAGATGAGACACCGATGGTCAGCTACATTAATGTGCATGC
CATACTAGATGCAAGGAGACGTTTTGCCAAAGCTTCCACATCCAATGATCCAGAATCTTCTCAGGGACCTCGGGTTATTG
TAGTAGGGCCTACGGATTCCGGGAAGAGCACATTGACAAAGATGCTCCTTAGTTGGGCAGCTAAACAGGGATGGAGACCT
ACATTTGTAGACCTTGATGTTGGCCAAGGCTCGATTACAATACCAGGATGTATTGCTGCTGCCCCTATTGAAATGCCACT
GGATCCAGTTGAAGGGTTTCCTCTTGATATGGCCCTTGTGTACTACTACGGCCATGCATCACCAAATATCAACGTTGAAC
TGTACAAAGCTCTGGTGAAAGAGCTGGCTCAAGTTCTGGAGAGACAGTTTGTCGGAAACCCTGAATCTCGAGCTGCTGGA
ATGGTGATCAACACAATGGGATGGATCGAGGGTATTGGTTATGAGCTGCTTCTCCACGCAATAGACACATTCAATGCCTC
GGTTGTACTTGTATTGGGTCAGGAAAAACTCTTCAGCAGGCTTAAAGATGTGCTGAGAAGTAAGAGTAATGTCGACGTTG
TGAAACTTCACAAGTCTGGTGGAGTTGTAGCCAGGGTCAAAGAGGTCCGTAAAAGATCAAGGAATTTTAAGATTCAGGAA
TATTTTTACGGTTTATCGAAAGAACTCTCTCCGTATGCCAATACATCGAGTTTCAGTGATCTGCAAGTGTTCCGAATTGG
TGGTGGACCACAAGCGCCAAAATCAGCTCTTCCAGCCGGGTCTACCTCGGTTTCAAATCCGTTGCGGGTGACACCTGTAA
ATATCGATGATCGGGATCTACTGCATTCTGTTCTCGCTGTCTCATACGCAGAAGAACCAGACCAGATCATCTCAAGCAAT
GTTTCTGGGTTTGTGTATGTGACGGAAGTTAATGTGCAGAAGAAGAAGATAACGTATTTAGCACCATCGCCTGGGACATT
ACCTAGCAAGTTGTTGGTCGCTGGATCATTGACATGGCTTGAGTCAGTATGA