Details for Lyrate rockcress Locus 16041723

Position : sca3 ( 5`- 4015189 .. 4012595 -3` )
Annotation : [B2G] l-o-methylthreonine resistant 1
External links : CoGe
PGDD synteny : 16041723

Protein [Map View]
MDSVRLPTAPSTLRSHIPLPSKPVIGITHFSRSRIPVAVMSRDETSMAPPPPKAPLPRLKVSPNSLQYPAGYLGAVPERT
NEPENGSIVEAMEYLTNILSTKVYDIAIESPLQLAKKLSKRLGVRMFLKREDLQPVFSFKLRGAYNMMVKLPADQLAKGV
ICSSAGNHAQGVALSASKLGCTAVIVMPVTTPEIKWQAVENLGATVVLFGDSYDQAQAHAKIRAEEEGLTFIPPFDHPDV
IAGQGTVGMEITRQAKGPLHAIFVPVGGGGLIAGIAAYVKRVAPEVKIIGVEPADANAMALSLHHGERVILDQVGGFADG
VAVKEVGEETFRISRNLMDGVVLVTRDAICASIKDMFEEKRNILEPAGALALAGAEAYCKYYGLKDVNVVAITSGANMNF
DKLRIVTELANVGRQQEAVLATLMPEKPGSFKQFCELVGPMNITEFKYRCNSEKEAVVLYSVGVHTAGELKALQKRMESS
QLRTVNLTTSDLVKDHLRYLMGGRSTVGDEVLCRFTFPERPGALMNFLDSFSPRWNITLFHYRGQGETGANVLVGIQVPE
QEMEEFKNRAKALGYDYFLVSDDDNFKLLMH*

DNA
ATGGATTCCGTTCGGCTTCCAACGGCGCCATCCACTCTCCGTAGCCACATTCCCCTGCCATCAAAACCAGTGATCGGAAT
CACTCACTTCTCCCGCTCTCGGATCCCAGTGGCTGTTATGTCACGAGACGAAACATCTATGGCTCCGCCGCCTCCAAAGG
CTCCTTTACCACGGCTCAAAGTCTCTCCGAATTCGTTGCAATACCCAGCCGGTTACCTCGGTGCGGTACCAGAACGTACG
AACGAGCCTGAGAACGGAAGCATAGTCGAAGCTATGGAGTATTTGACGAATATACTGTCCACTAAGGTTTACGACATCGC
CATTGAGTCACCACTTCAATTGGCTAAGAAGCTATCTAAGAGATTAGGTGTTCGTATGTTTCTTAAAAGAGAAGACTTGC
AACCTGTATTCTCGTTTAAGCTTCGTGGAGCTTACAATATGATGGTGAAACTTCCAGCAGATCAATTGGCAAAAGGAGTT
ATCTGCTCTTCAGCTGGAAACCATGCTCAAGGAGTTGCTTTATCTGCTAGTAAACTCGGCTGCACTGCTGTGATTGTTAT
GCCTGTTACAACTCCTGAGATTAAGTGGCAAGCTGTAGAGAATTTGGGTGCAACGGTTGTTCTTTTCGGGGATTCGTATG
ATCAAGCACAAGCACATGCTAAGATACGAGCTGAAGAAGAGGGTCTGACGTTTATACCTCCTTTTGATCACCCTGATGTT
ATTGCTGGACAAGGGACTGTCGGGATGGAGATCACTCGTCAGGCTAAGGGTCCATTGCATGCTATATTTGTGCCAGTTGG
TGGTGGTGGTTTAATAGCTGGTATTGCTGCTTATGTGAAGAGGGTTGCTCCCGAGGTGAAGATCATTGGTGTAGAACCAG
CTGATGCAAATGCAATGGCGTTGTCGCTGCATCACGGTGAGAGGGTGATATTGGACCAGGTTGGGGGATTTGCAGATGGT
GTAGCAGTTAAAGAAGTTGGTGAAGAGACTTTTCGTATAAGCAGAAATCTAATGGATGGTGTTGTTCTTGTCACTCGTGA
TGCTATTTGTGCATCAATAAAGGATATGTTTGAGGAGAAACGGAACATATTGGAACCAGCAGGGGCTCTTGCGCTCGCTG
GAGCTGAGGCATACTGTAAATATTATGGCCTAAAGGACGTGAATGTAGTAGCCATAACCAGTGGTGCTAACATGAACTTT
GACAAGCTAAGGATTGTGACAGAACTCGCCAATGTCGGTAGGCAACAGGAGGCTGTTCTTGCTACACTCATGCCGGAAAA
ACCTGGAAGCTTTAAGCAATTCTGTGAGCTGGTTGGACCAATGAACATAACCGAGTTCAAATATAGATGTAACTCGGAAA
AGGAGGCTGTTGTACTATACAGTGTCGGAGTTCACACTGCCGGAGAGCTCAAAGCACTACAGAAGAGAATGGAATCTTCT
CAGCTCAGAACTGTCAATCTCACAACCAGTGACTTAGTGAAAGATCACCTGCGTTACTTAATGGGAGGAAGATCTACTGT
TGGAGACGAGGTTCTATGCCGATTCACCTTCCCCGAGAGGCCTGGTGCTCTAATGAACTTCTTGGACTCTTTCAGTCCAC
GGTGGAACATCACCCTTTTCCATTACCGTGGACAGGGTGAGACGGGCGCGAATGTGCTGGTCGGGATCCAAGTCCCTGAG
CAAGAAATGGAGGAATTTAAAAACCGAGCTAAAGCTCTTGGATACGACTACTTCTTGGTAAGTGATGACGACAATTTTAA
GCTTCTGATGCACTGA