Details for Lyrate rockcress Locus 16041431

Position : sca3 ( 5`- 1588296 .. 1584774 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477721 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16041431

Protein [Map View]
MAEAEDEQNFVAHNGDQVPAQGLDEVHNGLPYQVHQPYEVSDPILEPQQYEVPDQTLEPQQYELPDQTLEPQQYEVQDQL
EYQQYQLQDQTHEDVQDQPQDDLKYQPQDQEPYQLQDEAHDQAQYQAEGEAQDHNGDDVQDKVEDEEGISESLQKSESEE
GATVGGEEKRWPGWPGETVFRMLVPAQKVGSIIGRKGDVIKKIVEETRARIKILDGPPGTTERAVMVSGKEEPESSLPPS
MDGLLRVHMRIVDGLDGEPSQAPPASKVSTRLLVPASQAGSLIGKQGGTVKAIQEASACIVRVLGSEDLPVFALQDDRVV
EVVGEPTSVHKALELIASHLRKFLVDRSIIPFFENQMQKPTRQMDHMPAPHQAWGPPQGHAPSVGGGGYGHNPPPYMQPP
PRHDSYYPPPEMRQPPMEKQPHQGISAYGREPPMNVHVSSAPPMVAQQVTQQMQIPLSYADAVIGTSGSNISYTRRLSGA
TVTIQETRGVPGEMTVEVSGTGSQVQTAMQLIQNFMAEAGAPAPAQPQTVAPEQQGYNPYATHGSVYAAAPTNPPGGYAT
DYSSGYGY*

DNA
ATGGCTGAAGCTGAAGATGAGCAAAATTTTGTTGCACACAATGGAGATCAGGTACCAGCTCAGGGGTTAGATGAGGTGCA
TAATGGGTTACCGTACCAGGTTCACCAACCATACGAGGTATCAGATCCGATTCTTGAACCTCAGCAGTACGAGGTACCAG
ATCAGACTCTTGAACCTCAGCAGTACGAGCTACCAGATCAGACTCTTGAACCTCAGCAGTACGAGGTTCAGGATCAATTA
GAGTATCAACAATACCAGTTGCAGGACCAGACTCATGAAGATGTCCAAGATCAGCCGCAAGATGACCTAAAATATCAGCC
ACAAGATCAGGAGCCGTATCAGTTACAAGACGAGGCTCATGATCAGGCCCAGTATCAGGCAGAAGGTGAGGCACAAGATC
ACAATGGTGATGATGTGCAAGATAAAGTAGAAGATGAGGAAGGAATTTCTGAGTCTCTACAGAAATCAGAGTCTGAAGAA
GGTGCAACAGTTGGAGGTGAGGAGAAGAGGTGGCCGGGATGGCCCGGAGAGACGGTCTTCCGCATGCTGGTTCCTGCACA
GAAAGTGGGTAGTATCATTGGTCGCAAAGGTGATGTCATTAAGAAAATAGTTGAGGAGACAAGGGCTCGAATAAAGATTC
TCGATGGTCCTCCAGGCACAACCGAAAGAGCTGTTATGGTTTCTGGTAAAGAAGAGCCCGAATCATCTCTACCACCTTCT
ATGGATGGCCTTCTTAGAGTGCACATGCGGATAGTTGATGGTTTGGATGGTGAACCTTCTCAAGCCCCTCCAGCTTCAAA
GGTGTCAACAAGATTACTAGTCCCAGCATCTCAGGCTGGAAGTTTGATTGGAAAACAGGGAGGAACAGTTAAAGCTATTC
AAGAAGCATCCGCTTGTATAGTCAGAGTTCTTGGATCAGAGGATTTGCCTGTATTTGCTCTTCAAGACGATAGAGTTGTT
GAAGTTGTGGGGGAACCAACAAGTGTTCATAAAGCCTTGGAGCTGATTGCATCACATCTAAGAAAGTTCTTGGTTGATCG
TAGCATCATCCCATTCTTTGAAAATCAGATGCAAAAGCCAACTCGCCAAATGGATCATATGCCAGCACCACATCAGGCAT
GGGGTCCTCCTCAAGGTCATGCCCCAAGTGTTGGTGGAGGAGGCTATGGTCACAACCCACCTCCATATATGCAACCACCT
CCTAGACATGATAGTTACTATCCTCCTCCTGAGATGCGTCAACCTCCAATGGAGAAACAGCCTCATCAAGGTATATCTGC
ATATGGTAGAGAGCCTCCTATGAATGTGCACGTATCATCAGCCCCACCAATGGTCGCTCAGCAAGTTACGCAGCAAATGC
AGATTCCACTTTCTTATGCTGATGCTGTAATTGGGACATCAGGTTCAAACATAAGCTACACTAGACGTCTTAGTGGAGCA
ACAGTAACTATTCAGGAGACGAGGGGAGTACCTGGTGAAATGACTGTTGAGGTTAGCGGAACTGGCTCACAAGTCCAAAC
TGCTATGCAGCTTATTCAGAACTTCATGGCTGAAGCTGGAGCGCCAGCACCAGCACAACCTCAAACTGTAGCACCCGAGC
AGCAAGGCTATAACCCATACGCAACACACGGCTCAGTCTACGCAGCGGCTCCAACAAACCCGCCTGGAGGATACGCTACG
GATTACAGCTCAGGCTACGGTTACTGA