Details for Lyrate rockcress Locus 16041421

Position : sca2 ( 5`- 16502608 .. 16501383 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_476636 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16041421

Protein [Map View]
MASISNLAASLSSLSFSSQVSQRPNTISFPRANSVFALPAKSDRRSSLSITATVAAPPEEEEIIELKKYVKSRLPGGFAA
QKIIGTGRRKCAIARVVLQEGTGKVIINYRDAKEYLQGNPLWLQYVKVPLVTLGYENSYDIFVKAHGGGLSGQAQAITLG
VARALLKVSADHRSPLKKEGLLTRDARVVERKKAGLKKARKAPQFSKR*

DNA
ATGGCGTCGATTTCGAACCTCGCCGCTTCTCTCTCTTCACTTTCGTTCTCCTCCCAAGTTTCTCAGAGACCTAACACCAT
TTCCTTTCCCCGCGCGAATTCGGTGTTCGCGTTACCGGCGAAATCCGACCGCCGCTCTTCCCTATCTATAACCGCCACGG
TAGCTGCTCCACCGGAGGAGGAGGAGATAATTGAGCTGAAGAAATACGTCAAATCAAGGCTTCCCGGAGGATTTGCTGCT
CAGAAGATTATTGGCACTGGACGGCGTAAGTGCGCAATTGCTAGAGTTGTGCTTCAGGAAGGCACTGGGAAGGTTATCAT
AAACTATCGTGATGCCAAGGAGTACCTTCAGGGAAATCCACTATGGCTTCAGTATGTTAAAGTCCCACTAGTGACTTTAG
GGTATGAGAACAGCTACGACATATTTGTGAAAGCCCATGGAGGCGGTCTCTCAGGTCAAGCTCAAGCTATTACCCTGGGA
GTCGCACGTGCACTCCTCAAGGTAAGTGCAGACCACAGATCGCCTTTGAAGAAGGAAGGTTTGCTCACTAGAGATGCGAG
AGTGGTTGAAAGAAAGAAGGCCGGGCTCAAGAAGGCGCGTAAAGCACCACAATTCTCCAAGCGTTAA