Details for Lyrate rockcress Locus 16041392

Position : sca3 ( 5`- 1775257 .. 1774498 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041392

Protein [Map View]
MKNSSLLFILIVVISSSENGKMIGEAKKCSNSWICEGDEKCKEKCMADYKGNGTCYYPSPPSKQHPEFSYPTCWCGFQC*

DNA
ATGAAAAACTCTTCTCTTTTATTCATACTAATTGTCGTTATTTCTTCTTCAGAAAACGGCAAAATGATAGGAGAAGCAAA
AAAGTGTAGTAATTCATGGATTTGTGAAGGAGACGAGAAATGCAAAGAGAAGTGCATGGCTGACTACAAAGGCAATGGAA
CATGTTATTACCCATCTCCTCCTTCAAAACAACATCCTGAGTTTTCTTATCCTACATGCTGGTGTGGGTTTCAGTGTTAA