Details for Lyrate rockcress Locus 16041371

Position : sca3 ( 5`- 4868198 .. 4870283 -3` )
Annotation : [B2G] aha1 domain-containing protein
External links : CoGe
PGDD synteny : 16041371

Protein [Map View]
MAKFGEGDKRWIVEDRPDGTNVHNWHWSETNCLEWSRNFFTKQFSGVVILSGEGNLFIKVNKIEKVEGEAYVNVRKGKII
PGYELNVSLSWEGEAKDSDGKTLLKADGLVDMPYISDENADEDPEIRFSVKDEGPIGRTLKEAMVKKGKSIILEKVRVYV
EAMAKGGPCRDELESKKVAPKSVAAGSAPVAVEKSGGAPVVSAAAVETKVVKEKKKAKTKEGFKTITMTEKFNCRAKDLY
EILMDENRWKGFTQSNAKISKDVNGPISVFDGSVTGMNLELEEGKLIVQKWRFGSWPDGLDSTVKIVFEEPQPGVTIVNL
THTDVPEEDRYGNATVVENTERGWRDLIFHRIRAVFGFGI*

DNA
ATGGCAAAGTTCGGCGAAGGTGACAAGAGATGGATCGTAGAAGACAGACCTGACGGCACCAACGTCCATAACTGGCACTG
GTCCGAAACCAATTGCCTTGAATGGTCTCGCAACTTCTTCACCAAACAATTCTCCGGCGTTGTTATCCTCTCCGGCGAAG
GTAATCTATTCATCAAGGTCAATAAGATCGAGAAAGTCGAAGGCGAGGCTTATGTGAATGTAAGGAAGGGGAAGATTATC
CCTGGTTACGAGCTTAATGTCTCTTTATCTTGGGAAGGTGAGGCCAAAGATTCCGATGGGAAGACGCTGTTGAAAGCTGA
TGGATTGGTGGATATGCCTTATATCTCCGATGAGAATGCTGATGAAGATCCCGAGATTAGGTTTTCGGTGAAGGATGAGG
GACCGATTGGGAGGACTTTGAAGGAGGCGATGGTGAAGAAGGGGAAATCGATTATTCTGGAGAAGGTTAGGGTTTATGTG
GAGGCTATGGCGAAAGGAGGTCCGTGTAGGGATGAATTGGAATCGAAGAAGGTTGCGCCGAAATCTGTAGCGGCTGGATC
AGCTCCGGTGGCGGTGGAGAAGTCTGGTGGTGCCCCTGTGGTATCTGCTGCTGCGGTGGAGACTAAGGTAGTGAAGGAGA
AGAAGAAGGCGAAGACTAAGGAAGGGTTTAAGACAATTACTATGACTGAGAAGTTTAATTGCAGAGCTAAGGATTTGTAT
GAGATTTTAATGGATGAGAATCGTTGGAAAGGTTTTACGCAGAGCAATGCTAAGATTAGTAAAGATGTGAATGGTCCGAT
TAGTGTCTTTGATGGGTCTGTTACTGGAATGAATCTTGAGCTTGAAGAAGGCAAATTGATTGTTCAGAAGTGGAGATTTG
GGAGCTGGCCTGATGGTCTTGATTCAACGGTGAAGATCGTTTTCGAGGAGCCTCAACCAGGAGTCACCATTGTCAATCTT
ACTCACACTGACGTTCCTGAAGAGGACAGATATGGGAATGCGACTGTGGTGGAAAACACTGAGAGAGGATGGAGAGATCT
TATATTCCATAGGATCCGTGCAGTTTTCGGATTTGGAATATGA