Details for Lyrate rockcress Locus 16041316

Position : sca3 ( 5`- 7750429 .. 7749163 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041316

Protein [Map View]
MAEGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRLTGHSHFVEDVVLSSDGQFALS
GSWDGELRLWDLATGVSTRRFVGHTKDVLSVAFSVDNRQIVSASRDRTIKLWNTLGECKYTISEQGDGHKEWISCVRFSP
NTLVPTIVSASWDHTVKVWNLQNCKLRNSLVGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEGKKLYSLEAGSIIHS
LCFSPNRYWLCAATENSIKIWDLESKSVVEDLKVDLKAEAEKTDGGVGTGNQKKVNYCTSLNWSADGSTLFSGYTDGVVR
VWGIGRY*

DNA
ATGGCCGAGGGACTCGTATTGAAGGGCACTATGCGCGCCCACACCGACATGGTCACCGCCATCGCTACACCGATCGACAA
TTCCGACATCATCGTCACAGCGTCGCGTGACAAATCCATCATCCTCTGGAAACTCACCAAGGACGACAAGTCTTACGGTG
TTGCTCAGCGTAGGCTCACAGGTCACTCTCACTTCGTCGAAGATGTTGTTCTCTCATCGGACGGTCAGTTTGCACTCTCC
GGAAGCTGGGACGGTGAGCTCCGTCTCTGGGATCTCGCTACTGGTGTCTCCACTCGCAGATTCGTCGGACACACGAAAGA
TGTGCTCTCTGTAGCATTCTCTGTTGATAACCGTCAGATCGTATCAGCGTCTCGTGACCGTACGATCAAGCTGTGGAACA
CACTCGGTGAATGCAAGTACACGATCTCTGAGCAAGGAGATGGTCACAAGGAATGGATTAGCTGTGTGAGGTTTAGCCCT
AACACGCTTGTGCCTACCATTGTTTCTGCTTCATGGGATCACACCGTGAAAGTCTGGAATCTCCAGAACTGTAAGCTGAG
GAACTCTCTTGTTGGTCACTCTGGTTATCTCAACACCGTGGCTGTCTCGCCTGATGGTTCGCTATGTGCCAGTGGTGGGA
AAGATGGTGTTATCTTGTTGTGGGATTTGGCTGAAGGAAAGAAGTTGTATTCGCTTGAGGCTGGCTCGATTATTCACTCG
CTTTGCTTCAGTCCTAACAGATACTGGTTGTGTGCTGCTACTGAGAATAGCATTAAGATATGGGATCTTGAGAGCAAGTC
TGTTGTTGAGGACTTGAAGGTTGATCTTAAGGCTGAGGCAGAGAAGACTGATGGTGGTGTTGGAACTGGTAACCAAAAGA
AGGTGAATTACTGCACAAGCTTGAACTGGAGTGCAGATGGAAGCACATTGTTCAGTGGTTACACTGATGGAGTTGTCAGA
GTCTGGGGTATTGGTCGTTACTAG