Details for Lyrate rockcress Locus 16041291

Position : sca3 ( 5`- 9216593 .. 9213602 -3` )
Annotation : [B2G] metal transporter family protein
External links : CoGe
PGDD synteny : 16041291

Protein [Map View]
MDSQMLVALGLSLVGGLSTSLGALFVVLSETPNMKMLGLLQGFAAGLMLSISFLDLAHNAINSIGFLKANLWFFGGVIFF
ACIAKFIPEPTVGPSTDVKRRKKNGDEGGKDMMKKHRKQVLYSGLITAIGISLHNFPEGMAVFLGSIKGMRVGVNLALAI
ALHNIPEGVAVALPIYFATESKWQAFKLATLSGLAEPLGVIIVAYLFPRSLSPEILEGLLGAVGGIMAFLTLHEMLPLAF
DYAGQKQAVKAVFFGMACMSASLYFLELSLPDTMSL*

DNA
ATGGATTCTCAGATGCTCGTGGCGCTTGGACTATCCCTTGTTGGGGGATTAAGTACTTCTTTAGGTGCGCTTTTCGTAGT
TCTTAGTGAGACTCCCAATATGAAGATGCTTGGTCTTCTACAGGGTTTTGCGGCAGGTCTGATGTTGAGCATATCGTTCC
TGGATTTGGCTCATAATGCTATTAACTCTATTGGGTTCTTAAAAGCCAATCTCTGGTTTTTCGGTGGTGTGATATTCTTT
GCGTGTATTGCCAAATTCATACCCGAACCAACAGTTGGTCCTTCTACTGACGTGAAAAGAAGAAAGAAAAATGGAGACGA
GGGAGGTAAAGACATGATGAAAAAGCATCGCAAGCAAGTCTTATATAGTGGACTTATTACAGCTATAGGCATAAGCTTGC
ACAATTTTCCAGAAGGGATGGCTGTATTTCTCGGATCAATTAAGGGCATGCGAGTTGGTGTTAATCTGGCTTTGGCCATC
GCTTTACACAACATTCCTGAGGGTGTTGCAGTTGCACTTCCTATTTATTTTGCAACAGAAAGCAAATGGCAGGCATTTAA
GTTGGCAACACTCTCTGGTTTAGCTGAGCCTCTAGGTGTAATTATCGTGGCCTATCTTTTCCCAAGAAGCTTAAGTCCAG
AAATCCTTGAAGGTTTGTTGGGAGCAGTGGGTGGAATCATGGCTTTCCTAACGTTGCACGAAATGCTTCCTTTGGCATTT
GATTATGCGGGACAGAAACAAGCTGTGAAGGCTGTGTTTTTTGGCATGGCATGTATGTCTGCGAGTCTTTACTTTCTGGA
GCTGAGTTTACCTGATACAATGAGCTTGTAA