Details for Lyrate rockcress Locus 16041215

Position : sca3 ( 5`- 6309635 .. 6308522 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041215

Protein [Map View]
MDSTWNDHQELEQFEAIDDLLEDFWFFDNLLDRRSRILRYCHSDPYPFSPSSSSSSSSTCPKPEIPKIGDSDSETKLLEA
STGGGSVPPPCIEKKEGGGEPEKINKMMRRQFSEKVRVQERRTYLQKKEPVVREKGIKEGSRKNKTSSTSSCSNNNSSMG
GGLQRTQTLPSYIGREGDVNEFQDQEIDDSRMGFLIREAIASSSSSSGLTPTKHNTPKISSIPRHRPPRNSRSEEAIQEL
VVKSQRSPNRKTLRKTLSSIETKDIQMLKDLDIELEKKQEEEQRSVPRATAKTRSTAVVGQPIPVWVPKDSRKDMKAQIK
FWARTVASNVRQEC*

DNA
ATGGATTCTACTTGGAATGATCATCAAGAATTGGAGCAATTCGAAGCCATTGATGATCTTCTCGAAGATTTCTGGTTCTT
TGATAATTTACTTGATAGAAGATCAAGGATCTTGAGGTACTGTCACTCAGATCCTTACCCTTTTTCTCCCTCATCTTCTT
CTTCTTCTTCATCCACTTGTCCGAAACCCGAAATCCCGAAAATTGGAGATTCGGATTCGGAGACTAAGCTTCTAGAAGCT
TCCACTGGGGGAGGCTCTGTTCCACCGCCGTGTATAGAGAAAAAAGAAGGTGGAGGCGAGCCTGAGAAGATAAATAAGAT
GATGAGAAGGCAGTTCTCTGAGAAGGTTAGGGTTCAAGAACGAAGAACTTACTTGCAAAAGAAGGAACCTGTGGTTCGAG
AAAAGGGAATTAAAGAAGGTTCGAGGAAGAACAAAACAAGTAGTACTAGTAGTTGTAGTAACAATAATAGCTCGATGGGA
GGGGGGTTGCAGAGAACTCAGACATTGCCGAGTTACATAGGAAGAGAAGGCGATGTAAATGAGTTTCAAGATCAAGAGAT
TGATGATTCAAGAATGGGATTCTTGATCCGTGAAGCCATCGCTAGCTCTTCTTCTTCTTCTGGACTTACTCCAACGAAAC
ACAACACTCCAAAGATTTCAAGCATTCCAAGGCATAGACCACCGAGAAACTCGAGATCAGAAGAGGCTATTCAAGAATTA
GTCGTCAAATCACAAAGAAGCCCAAATCGCAAAACGCTGCGTAAAACGTTAAGCAGCATCGAGACGAAAGATATTCAAAT
GTTAAAGGATTTGGACATTGAATTAGAGAAGAAGCAAGAAGAGGAACAGAGGAGTGTCCCACGCGCCACCGCGAAAACAC
GGTCTACAGCGGTCGTGGGACAGCCGATTCCGGTATGGGTTCCAAAGGATTCGAGAAAAGACATGAAAGCTCAAATAAAG
TTCTGGGCTCGAACTGTCGCAAGTAATGTTCGACAAGAATGCTGA