Details for Lyrate rockcress Locus 16041196

Position : sca3 ( 5`- 919105 .. 915318 -3` )
Annotation : [B2G] sugar transporter family protein
External links : CoGe
PGDD synteny : 16041196

Protein [Map View]
MGFDPENQSISSVGQVGDSSSGEINAQKEPLIKENHSPENYSVLAAIPPFLFPALGALLFGYEIGATSCAIMSIKSPTLS
GITWYDLSSVDVGILTSGSLYGALIGSIVAFSVADTIGRRKELILAAFLYLVGAIVTVVAPAFSILIIGRVTYGMGIGLT
MHAAPMYIAETAPSQIRGRMISLKGIFHCSWDGCYGIGSLWVTVISGWRYMYATILPLPVIMGIGMCWLPASPRWLLLRA
LQRKGNVENLQQAAIRSLRRLRGSAIADSAAEQVNEILAELSFVGEDKEATFGELFRGKCLKALTIAGGLVLFQQITGQP
SVLYYAPSILQTAGFSAAADATRISILLGLLKLVMTGLSVIVIDRVGRRPLLLGGVSGMVISLFLLGSYYMFYKTVPAVA
VAALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRGISLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVVSLFF
IYYIVPETKGLTLEEIEAKCL*

DNA
ATGGGGTTTGATCCCGAGAACCAATCGATTTCTTCCGTTGGACAGGTTGGTGATTCTTCTTCAGGTGAGATCAATGCTCA
AAAGGAACCTTTGATAAAAGAGAATCACAGCCCAGAAAACTACTCTGTTCTTGCAGCCATTCCCCCGTTTCTTTTTCCAG
CTCTTGGAGCGTTGCTTTTTGGTTATGAAATTGGTGCGACATCTTGTGCTATCATGTCTATTAAGTCGCCTACTCTAAGT
GGAATTACATGGTACGACTTGTCTTCAGTCGATGTTGGTATACTTACCAGTGGCTCACTGTATGGTGCCTTAATTGGCTC
CATTGTTGCATTTAGTGTTGCCGACACTATAGGAAGGAGAAAGGAGCTGATTTTGGCTGCATTCTTGTATCTTGTCGGAG
CCATTGTGACTGTAGTAGCACCTGCCTTTTCCATACTGATAATTGGACGAGTTACGTATGGCATGGGGATTGGACTGACA
ATGCACGCGGCTCCAATGTACATTGCAGAGACTGCTCCTAGTCAAATACGTGGACGGATGATATCACTGAAAGGAATTTT
CCACTGTTCTTGGGATGGTTGTTATGGAATCGGTAGCCTTTGGGTTACTGTTATTTCTGGCTGGCGTTATATGTACGCAA
CAATTCTCCCTTTGCCAGTTATTATGGGAATTGGAATGTGTTGGCTACCAGCATCTCCGAGGTGGCTTTTATTGCGCGCT
CTCCAGAGAAAAGGGAATGTGGAGAATCTTCAACAGGCTGCAATTAGGTCTCTTCGTCGCCTTAGAGGGTCTGCCATAGC
TGACTCAGCAGCTGAACAAGTAAACGAGATCTTGGCTGAACTTTCCTTTGTGGGTGAGGACAAAGAAGCTACATTTGGTG
AATTATTTCGAGGCAAATGCTTGAAAGCTCTCACAATAGCAGGAGGGTTAGTCTTGTTCCAACAGATAACTGGGCAACCA
AGTGTACTTTATTATGCACCATCAATACTACAGACTGCCGGCTTTTCTGCTGCAGCTGATGCAACTCGGATCTCAATTCT
GCTCGGTCTATTGAAGTTGGTTATGACAGGACTTTCTGTTATAGTTATTGACAGAGTTGGAAGGAGACCTTTACTTCTTG
GTGGTGTTAGTGGCATGGTGATCTCATTGTTCCTCCTGGGGTCCTACTACATGTTTTATAAAACTGTACCAGCTGTTGCT
GTAGCTGCATTGCTACTGTATGTAGGCTGTTACCAGCTATCCTTTGGCCCTATTGGTTGGCTGATGATTTCAGAGATATT
TCCATTAAAATTAAGAGGTCGAGGAATCAGTCTAGCAGTTCTTGTGAATTTCGGAGCAAACGCACTTGTGACATTCGCTT
TCTCACCTCTAAAGGAGCTTTTAGGAGCTGGAATCTTGTTCTGTGCATTTGGAGTGATATGTGTAGTGTCTCTCTTCTTC
ATATACTACATAGTGCCAGAGACAAAGGGTCTCACTCTTGAAGAAATTGAAGCCAAATGTCTCTAA