Details for Lyrate rockcress Locus 16041173

Position : sca3 ( 5`- 2669614 .. 2667699 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896779 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16041173

Protein [Map View]
MAVKKACEMFPKSLIEDVHKWGCMKQTGVSLRYMMEFGSKPTERNLLISAQFLHKELPIRVARRAIELQTLPYGLSEKPA
VLKVRDWYLESFRDMRAFPEIKDSGDEKEFTQMIKAVKVRHNNVVPMMALGVNQLKKGMNSGNLDEIHQFLDRFYLSRIG
IRMLIGQHVELHNPNPPLHTVGYIHTKMSPMEVARNASEDARSICFREYGSAPEINIYGDPSFTFPYVPTHLHLMMYELV
KNSLRAVQERFVDSDRVAPPIRIIVADGIEDVTIKVSDEGGGIARSGLPKIFTYLYSTARNPLEEEVDLGTADVPVTMAG
YGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSQEPLP*

DNA
ATGGCAGTGAAGAAGGCCTGCGAAATGTTCCCGAAGAGTTTGATCGAAGATGTTCACAAATGGGGTTGCATGAAGCAAAC
AGGTGTTAGCCTTAGATACATGATGGAGTTTGGTTCCAAACCTACTGAGAGGAATCTTTTGATTTCTGCTCAGTTTCTGC
ATAAGGAGCTTCCGATTCGCGTCGCCAGGAGAGCGATCGAACTCCAGACGCTTCCTTATGGTCTCTCTGAGAAACCTGCC
GTTTTGAAGGTGCGAGATTGGTATTTGGAATCTTTCAGGGACATGAGAGCATTTCCTGAGATTAAGGATTCGGGTGACGA
GAAAGAATTCACTCAGATGATTAAGGCTGTTAAGGTAAGGCACAACAATGTGGTTCCCATGATGGCTTTAGGTGTTAATC
AGCTCAAGAAAGGAATGAATTCCGGAAATCTTGATGAGATTCATCAGTTTCTTGATCGCTTCTACTTGTCCCGAATAGGG
ATCCGTATGCTTATTGGGCAGCATGTTGAGTTGCATAATCCAAATCCACCACTTCATACAGTGGGTTATATACACACAAA
GATGTCTCCTATGGAGGTAGCAAGGAATGCCAGTGAAGATGCTCGCTCAATTTGTTTCCGAGAGTATGGTTCTGCACCGG
AAATAAACATATATGGCGATCCCAGTTTCACCTTTCCGTATGTTCCAACGCATTTGCATCTTATGATGTATGAGCTAGTC
AAGAACTCTCTACGTGCTGTCCAAGAGCGATTTGTTGACTCTGATAGAGTTGCACCACCAATCCGCATTATAGTTGCAGA
TGGAATTGAAGATGTTACAATAAAGGTCTCAGATGAAGGTGGAGGTATAGCGAGAAGCGGTCTTCCCAAAATATTCACCT
ATCTTTACAGCACTGCAAGAAACCCGCTTGAGGAGGAAGTCGATTTAGGAACAGCTGATGTTCCGGTGACTATGGCTGGG
TATGGTTACGGTCTTCCAATTAGTCGCTTGTATGCTCGATATTTCGGTGGAGATTTGCAGATCATATCCATGGAAGGATA
TGGGACTGATGCTTACTTGCACTTGTCTCGCCTTGGAGATTCGCAAGAGCCTTTACCCTGA