Details for Lyrate rockcress Locus 16041157

Position : sca3 ( 5`- 6422344 .. 6423155 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041157

Protein [Map View]
MELDPKKFAALLDKIEAEADEFLLARNQMVENDKERNANREALTALRKRARTTKTSVLSPFDSMMKDIHVSSTKPLVQEV
CSTCGSHDSSEPNWMMLPGADLFAAIPFHAVHTMLEKDEEKMEFESKKLQSLVKEKALFISELGALADSTSPGVIRSLVA
LKDN*

DNA
ATGGAGTTGGATCCAAAGAAGTTTGCTGCACTATTGGACAAAATTGAAGCTGAAGCTGATGAGTTTCTATTAGCTCGAAA
TCAGATGGTGGAGAATGACAAGGAGAGGAATGCAAACCGAGAGGCTCTTACAGCACTTAGGAAGAGAGCTCGGACAACAA
AGACTAGTGTTCTGTCTCCATTCGATTCTATGATGAAAGATATACATGTGAGCTCAACGAAACCTTTGGTCCAAGAAGTT
TGCTCCACATGTGGATCCCATGATTCTAGTGAACCGAATTGGATGATGCTCCCAGGAGCTGATCTTTTTGCTGCAATTCC
GTTTCATGCTGTGCATACAATGCTAGAGAAAGATGAAGAGAAAATGGAGTTTGAATCGAAGAAATTGCAGAGCTTAGTGA
AGGAGAAAGCTCTGTTTATATCGGAACTCGGGGCTCTTGCTGATAGTACTTCTCCAGGCGTTATCAGATCGTTGGTGGCT
TTAAAGGATAACTAA