Details for Lyrate rockcress Locus 16041146

Position : sca3 ( 5`- 11003798 .. 11002698 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041146

Protein [Map View]
MDIGKALPASKEGESQMIVMMGNNLYLTSITLNGEPSIEQIDKLTCLDEQAKISQVFDCEGLLLCILKEDSRFVVLNPYL
GQTRWIEPRYSHRPYGCDRFSYALGYVNKESCRSYKLLRFIDYFYNVPEKQFFWYEIYDFDSDLWTTLDISPHWRIAFCN
PGVSLKGNTYFCAAERNVDVKEVLANSLICFDFTSERFGPLLPLPFSGGYHDYTTLSCVREEKLALLLQHDESNPYELDL
WITTKIETEEVLWSKFVRVATAGFDSYVPFIGGSFFIDEEKKVAIGFDDGDNRHKINIIGEAGYFRALDLVGDFGDQECK
TDLCSYVPSLVEIKQPEGGEREQESELEKLRYDENMSRLVLLEGNQ*

DNA
ATGGACATTGGTAAAGCCTTACCTGCATCAAAGGAAGGTGAGTCTCAGATGATCGTGATGATGGGTAACAATCTTTATTT
AACGAGCATTACTCTCAATGGAGAACCATCTATTGAGCAAATAGACAAACTTACTTGCCTTGACGAACAAGCCAAGATAT
CACAGGTCTTTGACTGCGAGGGCTTATTGCTATGCATATTGAAAGAAGATTCTAGGTTTGTGGTTCTGAATCCGTATTTG
GGGCAAACAAGGTGGATCGAACCAAGATATTCCCATCGTCCATACGGATGTGACAGGTTTAGTTATGCTCTCGGATACGT
GAATAAGGAATCTTGTCGTAGCTACAAGTTATTGAGGTTTATAGATTATTTCTACAATGTACCCGAAAAGCAGTTCTTTT
GGTATGAAATCTATGATTTTGACTCTGATTTATGGACGACTCTTGATATATCTCCACATTGGCGTATAGCATTTTGTAAC
CCTGGCGTTTCTCTTAAGGGAAACACTTACTTTTGTGCTGCTGAAAGGAACGTAGATGTAAAAGAAGTCTTGGCCAATAG
CTTAATCTGTTTCGATTTTACAAGTGAGAGATTTGGTCCGCTTCTGCCTCTGCCGTTTAGTGGTGGGTATCATGACTATA
CGACATTGTCTTGTGTTAGAGAAGAGAAGCTTGCGCTTTTACTTCAGCACGATGAATCAAATCCATATGAGCTTGACTTA
TGGATTACGACTAAGATTGAGACTGAAGAGGTGTTGTGGAGCAAGTTCGTGAGAGTGGCAACAGCTGGATTTGATAGTTA
TGTTCCATTTATAGGTGGAAGTTTCTTCATTGACGAGGAGAAGAAAGTCGCCATTGGTTTTGATGATGGGGATAATCGCC
ACAAAATTAACATCATTGGAGAGGCTGGATACTTCAGGGCATTGGATCTCGTTGGAGATTTTGGAGACCAAGAATGTAAG
ACAGATCTGTGCTCTTATGTTCCAAGTTTAGTGGAAATCAAGCAACCTGAAGGAGGAGAAAGGGAACAAGAAAGCGAATT
GGAGAAGCTTCGATATGATGAAAACATGTCGAGACTTGTCTTACTTGAAGGGAATCAATGA