Details for Lyrate rockcress Locus 16041142

Position : sca3 ( 5`- 8471954 .. 8475276 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16041142

Protein [Map View]
MVAAIPQAAAISSTDSKNPPRDRQDKPQLTANNGGLQRRPRAAKNVPSRYLSPSPSHPSTTTTATSTSSSSSSAVLRTSK
RYPSPLLSRSTNSASNLVKTPSSLPKRSQSVDRRRPSAVSDTRTEMSAATKMLITSTRSLSVSFQGEAFSLPISKKKETT
TPVSHRKSTPERRRATPVRDQRENSKPVDQQLWPGASRRGSSDSLVPNSLSRSVNCDSDGSGKLGSGFVGSSMLQHSQSS
RVSVDGRLNLDLGGGDGILEMRDESKTRPSTYPKLGSSVSCDFTASDTDSVSSGSTNGAQECCSGVNGEVSKTRGLPRNN
AVASAKFWQETNSRLRRFQDPGSPRSSSPSSRIRSISSSKFSQSKRFSSDSPLTSSPRGMTSPIRGATRPASPSKLWATA
TSTPARALSSPSRVRNGVSEQMNAYNRTLPSILCFSADIRRGKIGEDRVMDAHLLRLLYNRYLQWRFANARADSTFMVHR
LSAEKNLWNAWVSISELRHSVTLKRIKLLLLRQKLKLASILKEQIGYLEEWSFMDRDHSNSLSGATEALKASTLRLPISG
KALVDIQDLKHAVSSAVDVMHAMVSSIFSLTSKVEEMNSVMAEMVNITAKENVLLEQCQGFLSRVAAMQVTDCSMKTHII
QLSRI*

DNA
ATGGTGGCTGCGATTCCTCAAGCAGCAGCAATTTCCAGCACCGACTCTAAGAATCCACCTCGAGATCGACAAGACAAACC
TCAACTCACAGCTAACAATGGCGGACTACAACGAAGACCTAGAGCTGCTAAAAATGTCCCCTCGCGCTACTTATCTCCTT
CTCCTTCACATCCCTCGACCACCACCACTGCTACATCTACTTCCTCTTCTTCTTCGTCTGCGGTACTGAGGACAAGTAAG
CGATATCCTTCCCCTTTGCTCTCTCGCTCGACGAATTCTGCTTCTAATTTGGTTAAGACGCCTTCCTCGTTGCCCAAACG
GTCTCAATCGGTGGACCGTCGTCGTCCGTCGGCAGTTTCTGACACCAGAACGGAAATGTCGGCGGCGACGAAGATGCTTA
TCACTTCTACTAGGAGTTTATCTGTTTCTTTTCAAGGTGAGGCGTTTTCTCTTCCGATTAGTAAGAAGAAGGAGACTACC
ACGCCTGTTTCTCACCGGAAATCTACTCCTGAGAGGCGGAGAGCGACACCTGTTCGAGATCAGAGGGAGAATTCTAAGCC
GGTGGATCAGCAACTGTGGCCAGGTGCTTCTCGGAGGGGAAGTTCTGACTCTCTTGTGCCGAATTCGCTTTCTAGAAGCG
TGAATTGTGACAGTGATGGTAGTGGGAAGCTTGGATCTGGCTTTGTGGGAAGCTCAATGTTGCAGCATTCTCAGAGTTCT
AGGGTTTCTGTTGATGGGAGATTGAATTTGGATTTGGGAGGAGGTGATGGAATTTTGGAAATGAGAGATGAGAGCAAGAC
AAGACCAAGCACATATCCAAAATTGGGTTCTAGTGTTTCATGTGACTTTACTGCATCTGATACTGATAGTGTTTCATCTG
GTAGCACTAATGGTGCGCAGGAATGTTGTTCTGGTGTCAATGGTGAGGTTTCTAAAACAAGGGGCTTGCCGCGTAATAAT
GCTGTGGCTTCTGCTAAATTCTGGCAAGAGACTAATAGCCGGTTAAGGCGGTTTCAGGATCCTGGCTCACCTCGAAGTTC
TAGCCCAAGTTCGAGAATCAGGAGTATCTCATCATCAAAGTTCAGTCAATCGAAGCGGTTCTCTAGTGATAGTCCGTTGA
CATCATCTCCTCGCGGTATGACTTCTCCAATAAGGGGTGCTACTCGCCCTGCTTCACCAAGTAAGCTTTGGGCAACAGCT
ACATCAACTCCAGCTAGGGCACTTTCTAGTCCTTCCCGAGTGAGAAATGGAGTTTCTGAACAAATGAATGCTTATAACCG
CACCTTGCCTTCAATTCTTTGTTTCTCTGCTGATATTAGGAGGGGAAAAATTGGGGAGGATCGCGTTATGGATGCCCACT
TGTTGAGGCTTCTGTATAACCGTTATCTGCAATGGCGGTTTGCCAATGCGAGGGCGGACTCTACTTTCATGGTACATAGA
CTGAGTGCAGAGAAAAACCTCTGGAACGCATGGGTATCAATCTCGGAACTACGCCATTCTGTCACTCTGAAACGGATCAA
GTTGCTTTTGCTGAGGCAGAAACTGAAATTAGCTTCCATCTTGAAGGAGCAGATTGGTTATCTAGAAGAATGGTCTTTTA
TGGACAGAGATCATTCAAATTCTTTGTCAGGAGCGACTGAAGCTTTGAAAGCGAGCACACTTCGTCTTCCAATTAGTGGA
AAAGCCTTGGTTGATATTCAAGATCTCAAGCATGCTGTTAGTTCAGCCGTTGATGTCATGCACGCTATGGTGTCTTCGAT
TTTCTCGCTGACATCGAAGGTGGAGGAAATGAATTCAGTAATGGCGGAAATGGTGAATATCACTGCGAAAGAAAATGTTT
TGCTTGAACAGTGTCAAGGATTCTTATCAAGAGTAGCAGCAATGCAGGTAACGGACTGCAGCATGAAGACGCACATAATA
CAACTAAGCCGGATATAA